Loading...
The URL can be used to link to this page
Your browser does not support the video tag.
Home
My WebLink
About
2022-08-03 City Council Meeting Packet
Agenda City Council Meeting City of Edina, Minnesota Edina City Hall Council Chambers Wednesday, August 3, 2022 7:00 PM Watch the meeting on cable TV or at EdinaMN.gov/LiveMeetings or Facebook.com/EdinaMN. Participate in Community Comment and Public Hearings Call 888-504-7949 Enter Participant Passcode 416427 Press *1 on your telephone keypad when you would like to get in the queue to speak. An operator will introduce you when it is your turn. I.Call To Order II.Roll Call III.Pledge of Allegiance IV.Approval Of Meeting Agenda V.Community Comment During "Community Comment," the Mayor will invite residents to share issues or concerns that are not scheduled for a future public hearing. Items that are on tonight's agenda may not be addressed during Community Comment. Individuals must limit their comments to three minutes. The Mayor may limit the number of speakers on the same issue in the interest of time and topic. Individuals should not expect the Mayor or Council to respond to their comments tonight. The City Manager will respond to questions raised during Community Comments at the next meeting. A.City Manager's Response to Community Comments VI.Adoption Of Consent Agenda All agenda items listed on the Consent Agenda will be approved by one motion. There will be no separate discussion of items unless requested to be removed by a Council Member. If removed the item will be considered immediately following the adoption of the Consent Agenda. (Favorable rollcall vote of majority of Council Members present to approve, unless otherwise noted in consent item.) A.Approve Minutes: Work Session and Regular, July 19, 2022 B.Approve Payment of Claims C.Request for Purchase: 2022 Pavement Rejuvenation D.Request for Purchase: Sanitary Sewer Lift Station No. 6 Construction Phase Services E.Request for Purchase: Sanitary Sewer Lift Station No. 3 Construction Phase Services F.Request for Purchase: Sanitary Sewer Lift Station No. 6 Replacement G.Request for Purchase: Sanitary Sewer Lift Station No. 3 Replacement H.Request for Purchase: 69th Street Well House No. 5 Exterior Improvements I.Request for Purchase: Tra=c Control Cabinet for 76th & Edinborough Way J.Request for Purchase: Bury Overhead Power Lines on the Blake Road Project K.Approve Access and Construction License Agreement with Nine Mile Creek Watershed District for the Lynmar Basin Stormwater RetroAt Project L.Request for Purchase: McCauley Road Private Fence Replacement M.Request for Purchase: Braemar Parking Lot Resurfacing and Lighting N.Approve Tra=c Safety Report of June 28, 2022 O.Resolution No. 2022-66: Approving the Fencing Consortium Joint Powers Agreement P.Resolution No: 2022-69 Authorizing MN Department of Employment and Economic Development Grant Application for 4620 W. 77th Street Q.Ordinance No. 2022-07: Extending Term of the Franchise Held by Comcast R.Receive Petition for Construction of Walkways in Arneson Acres Park VII.Public Hearings During "Public Hearings," the Mayor will ask for public testimony after staG and/or applicants make their presentations. The following guidelines are in place to ensure an e=cient, fair, and respectful hearing; limit your testimony to three minutes and to the matter under consideration; the Mayor may modify times, as deemed necessary; avoid repeating remarks or points of view made by previous speakers. The use of signs, clapping, cheering or booing or any other form of verbal or nonverbal communication is not allowed. A.PUBLIC HEARING: People's Organic Liquor License Suspension VIII.Reports/Recommendations: (Favorable vote of majority of Council Members present to approve except where noted) A.Resolution No. 2022-71: Accepting Donations B.Resolution No. 2022-67: Accepting Donation from Dennis W. Schulstad C.Ordinance No. 2022-06: An Interim Ordinance Prohibiting the Sale, Testing, Manufacturing, and Distribution of THC Products D.Approve Summary Publication for Ordinance No. 2022-06 E.Resolution No. 2022-70: Awarding the Sale of $17 million General Obligation Temporary CIP Bonds, Series 2022B F.Ordinance No. 2021-07: OG-Street Parking Regulations G.Resolution No. 2022-62: Conditional Use Permit for Concord Elementary School, 5900 Concord Ave. H.Resolution No. 2022-61: Conditional Use Permit for Countryside Elementary School, 5701 Benton Ave. IX.Manager's Comments A.Quarterly Business Reports X.Mayor And Council Comments XI.Adjournment The City of Edina wants all residents to be comfortable being part of the public process. If you need assistance in the way of hearing ampliAcation, an interpreter, large-print documents or something else, please call 952-927-8861 72 hours in advance of the meeting. Date: August 3, 2022 Agenda Item #: V.A. To:Mayor and City Council Item Type: Other From:Sharon Allison, City Clerk Item Activity: Subject:City Manager's Response to Community Comments Information CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: None. INTRODUCTION: City Manager Neal will respond to questions asked at the previous council meeting. Date: August 3, 2022 Agenda Item #: VI.A. To:Mayor and City Council Item Type: Minutes From:Sharon Allison, City Clerk Item Activity: Subject:Approve Minutes: Work Session and Regular, July 19, 2022 Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Minutes as presented. INTRODUCTION: ATTACHMENTS: Description Minutes: Draft Work Session, July 19, 2022 Minutes: Draft Regular, July 19, 2022 MINUTES OF THE EDINA CITY COUNCIL WORK SESSION COMMUNITY ROOM, CITY HALL TUESDAY, JULY 19, 2022 5:30 P.M. CALL TO ORDER Mayor Hovland called the meeting to order at 5:34 p.m. ROLL CALL Answering roll call were Members Anderson, Pierce, Staunton, and Hovland. Absent: Member Jackson. Staff in attendance: Scott Neal, City Manager; Gillian Straub; City Management Fellow; Alisha McAndrews, Finance Director; Chad Millner, Engineering Director; Ross Bintner, Engineering Manager; Derik Otten, Facilities Manager; Jennifer Bennerotte, Communications Director; Chief Todd Milburn; Sgt. Brandon Kuske; Perry Vetter, Parks and Recreation Director; Nick Lovejoy, IT Security Analyst; and Sharon Allison, City Clerk. 2023-2028 CIP AND 2023 BUDGET Finance Director McAndrews reviewed the CIP and Budget timeline and said how she would share projects from departments and staff teams, and that subject matter experts were in attendance to answer questions. She said the next budget meeting would be in August and would include the utility rate study to be presented by Ehlers and Associates, and adoption of the preliminary levy in September. McAndrews reviewed the strategic policy and implementation and how these feeds into each other. She reviewed the Budget Goals and Values that informs the work staff does and guides decision making. She said from the $140M Consolidated Budget that staff would focus on the $80M Governmental funds and spoke about the Debt Service Levy projection which included Fire Station 2. McAndrews presented funding options for 2023-2028 CIP that included 383 projects totaling $359M over 6 years. She said projects were prioritized as high, medium, and low. She discussed CIP challenges such aging assets, capital needs outpacing available funding and others. Derik Otten, Facilities Manager, described several facilities that were in urgent need of repairs. McAndrews noted that there were some areas not currently funded that needs to be prioritized. She spoke about the Equipment Levy Funding and how it was data driven and included detailed replacement schedules with reliable funding source for these needs. Manager Neal spoke about the 2022-23 Budget Work Plan which was approved December 2021. Neal said staff would be paying a lot of attention to employees’ compensation, benefits, and practices to attract and retain a skilled and high-performing workforce. He recommended a 3 percent pay increase to be competitive with union increase of 4 to 4.5 percent. He spoke about the 2023 Tax Levy that was tentatively approved at 5.76 percent and said how Edina has a market value growth of 12.4 percent over 2021. Neal showed a levy projection option of 10 percent and explained that the tax impact on the median valued home of $659,900 would be a decrease of 1.1 percent in City property taxes or $23 annually. The next steps are City Manager’s CIP recommendation on Aug. 16, certify Preliminary Tax Levy on Sept. 20, present draft CIP to Oct. 20, and hold public hearing for the 2023 Budget Dec. 6. Council asked questions of staff and provided feedback. Edina City Council Work Session Meeting, July 19, 2022 DISCUSS FENCING CONSORTIUM JOINT POWERS AGREEMENT Chief Milburn and Sgt. Kuske said that based on Brooklyn Center’s experience during recent civil unrest, a fence was used to effectively create a buffer between police and protesters, and as a result, a metro-wide initiative was formed to purchase fences for use by consortium agencies. The fencing consortium, made up of approximately 53 local government agencies, would jointly contract with a fencing vendor for the availability, storage, maintenance, and transportation of the anti-scale fencing. They recommended the City Council joined the consortium. Council asked questions and provided feedback. ADJOURNMENT Mayor Hovland adjourned the meeting at 6:50 p.m. Respectfully submitted, ____________________________________________ Sharon Allison, City Clerk Minutes approved by the Edina City Council, August 3, 2022. ___________________________________________ James B. Hovland, Mayor Page 1 MINUTES OF THE REGULAR MEETING OF THE EDINA CITY COUNCIL MEETING JULY 19, 2022 7:00 PM I. CALL TO ORDER Mayor Hovland called the meeting to order at 7:00 p.m. then shared the procedure for public hearing and community comment. II. ROLLCALL Answering rollcall were Members Anderson, Pierce, Staunton, and Mayor Hovland. Absent: Member Jackson. III. PLEDGE OF ALLEGIANCE IV. MEETING AGENDA APPROVED AS AMENDED Member Staunton made a motion, seconded by Member Pierce, to approve the meeting agenda as amended, postponing Item IX.E. Ordinance No. 2022-07 Off-Street Parking Regulations to August 3, 2022. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. V. COMMUNITY COMMENT Alissa Movern, 5005 West 56th Street, shared her disappointment in the lack of communication regarding turf application as part of the sidewalk project in 2021 that lacked weed removal and watering and requested the turf be replaced. Director of Engineering Millner responded about delays with the contractor not following the project’s specifications but said staff was working to ensure completion of the turf replacement in a timely manner. Arnie Bigbee, 7621 Edinborough Way South, acknowledged the Council and staff for their work surrounding Juneteenth celebration and said he looked forward to future opportunities to welcome everyone in the community. Andrew Brown, 5512 Park Place, inquired about the status of the pedestrian bridge across Highway 62 and its potential replacement and the construction of a third fire station. Mr. Millner shared about the lack of response MnDOT received from bidders for the pedestrian bridge repair and that MnDOT was looking for grant opportunities and reviewing other options for its repair or possible replacement. V.A. CITY MANAGER’S RESPONSE TO COMMUNITY COMMENTS Manager Neal shared an update from the Community Comments from the last meeting. VI. CONSENT AGENDA ADOPTED AS PRESENTED Member Staunton made a motion, seconded by Member Pierce, approving the consent agenda as presented: V.A. Approve minutes of the Work Session and Regular Meeting of June 21, 2022 V.B. Approve Claims for Payment for Check Register Pre-List Dated June 24, 2022 (1011) totaling $492,183.23, Check Register Claims Pre-List Dated June 24, 2022 totaling $1,894,018.48, Check Register Claims Pre-List Dated June 27, 2022 totaling $20,000.00, Minutes/Edina City Council/July 19, 2022 Page 2 Check Register Claims Pre-List Dated July 1, 2022 totaling $1,485,058.15, Check Register Claims Pre-List Dated July 8, 2022 (1011) totaling $2,460.15, Check Register Claims Pre-List Dated July 8, 2022 totaling $846,660.82, Check Register Claims Pre-List Dated July 15, 2022 totaling $721,048.40 V.C. Approve Grant Agreement with Riley Purgatory Bluff Creek Watershed District for Cost-Share Purchase of Snow Removal Equipment for Braemar Arena V.D. Request for Purchase, Network Infrastructure Replacements, awarding the bid to the recommended low bidder, LOGIS (CDWG), $81,395 V.E. Adopt Ordinance No. 2022-05; Amending Chapter 20 of the Edina City Code Concerning Bulk Storage of Deicing Chemicals V.F. Request for Purchase, Land Management Plan Update 2022, awarding the bid to the recommended low bidder, RES, $28,720 V.G. Request for Purchase, Morningside Opti Predictive Pumping Services, awarding the bid to the recommended low bidder, OptiRTC, Inc., $57,700 V.H. Request for Purchase, Professional Services for City Hall Roof Replacement, awarding the bid to the recommended low bidder, Hammel Green and Abrahamson, Inc., (HGA), $55,273 V.I. Request for Purchase, Hughes Pavilion Gutters and Fascia, awarding the bid to the recommended low bidder, Green Construction Services, Inc., $23,350 V.J. Approve Traffic Safety Report of May 31, 2022 V.K. Approve 2022-2023 Union Contract for LELS Local 498 Police Officers V.L. Adopt Resolution No. 2022-64; Approving Participation of Hennepin County Housing and Redevelopment Authority in an Affordable Housing Project V.M. Adopt Ordinance No. 2022-04; Amending Chapter 4 Alcoholic Beverages Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. VII. SPECIAL RECOGNITIONS AND PRESENTATIONS VII.A. CITY MANAGEMENT FELLOW GILLIAN STRAUB – INTRODUCED Mr. Neal introduced City Management Fellow Straub to the Council and shared her background with the Council. Ms. Straub thanked the Council for the opportunity to serve in this role. VII.B. AFFORDABLE HOUSING PROGRESS REPORT – RECEIVED Affordable Housing Manager Hawkinson shared a summary report of affordable housing activity since 2015. She outlined the guiding documents and basis for affordable housing work that included the comprehensive plan, race and equity report, and Council’s statements on equity and engagement. She shared about rapidly increasing housing values that showed the average assessed value for 2022 was $797,800 and reviewed the need for affordable housing and the new multifamily affordable housing policy. She reviewed policy initiatives that were created to help with this goal then reviewed affordable housing projects that had been completed since 2015 and compared the inclusion of units versus the buy-in options for developers to meet the affordable housing requirement. Ms. Hawkinson reviewed home ownership and housing preservation efforts that included several different programs to reduce the number of home tear downs and stated 136 households have benefitted from the CH2E program through the Edina Housing Foundation. She reviewed the FirstGeneration Homebuying program then reviewed challenges for affordable housing that included 93% of existing residential land use was slated for single family housing, the availability of land for redevelopment, and current land cost. VIII. PUBLIC HEARINGS - Affidavits of Notice presented and ordered placed on file. VIII.A. RESOLUTION NO. 2022-61; CONDITIONAL USE PERMIT FOR COUNTRYSIDE ELEMENTARY SCHOOL, 5701 BENTON AVENUE – CONTINUED TO AUGUST 3, 2022 Community Development Director Teague said Edina Public Schools had requested a conditional use permit for building additions and an expanded parking lot at Countryside Elementary School located at 5701 Benton Avenue. The goal of the expanded parking lot was to make the site safer by separating parent and bussing Minutes/Edina City Council/July 19, 2022 Page 3 drop off areas. He said six classroom additions and expanded parking was being proposed then shared the existing configuration and explained the current parent drop off areas with several conflicting points of buses and pedestrians with only access off of Benton. He said the district was proposing to add another access off Tracy Avenue and change the parent drop off to the north side of the building. Mr. Teague stated all setbacks would be met and that feedback from Better Together focused on the need for increased landscaping and parking lot screening that would result in additional plantings in the gap areas with evergreens to provide year-round screening. He stated the CUP criteria would be met, no negative impacts would occur to roadways, lighting standards would be met, no sight line issues or impacts to surrounding property owners would occur and that staff and the Planning Commission recommended approval. He noted the Planning Commission had added a condition regarding EV charging stations be installed and that the district already agreed to install conduit in 2023. Maria Kennedy, Wold Architects, said the proposed construction schedule would begin fall 2022 with completion December 2023, with the parking area slated for the summer. Eric Hamilton, Director of Buildings and Grounds for Edina Public Schools, said the project would not have direct impact to busing and would begin on the south side of the site. He said they intend to close the upper playground for safety reasons but the lower area playground would still be available. He shared about the topography that would act as a barrier for car lights and that berming and landscaping would be included along Benton. Mr. Hamilton noted there was a grade difference already in place and filling in the bermed area at Stewart would help with lighting concerns and screening as well then spoke about the planned installation of charging stations. Mayor Hovland opened the public hearing at 7:49 p.m. Public Testimony No one addressed the Council. The Council asked questions and provided feedback. Member Pierce made a motion, seconded by Member Staunton, to close the public hearing at noon on July 25, 2022, and continue action on Resolution 2022-61, approving a conditional use permit for Countryside School at 5701 Benton Avenue, to the August 3, 2022, City Council meeting. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. VIII.B. RESOLUTION NO. 2022-62; CONDITIONAL USE PERMIT FOR CONCORD ELEMENTARY SCHOOL, 5900 CONCORD AVENUE – CONTINUED TO AUGUST 3, 2022 Mr. Teague said Edina Public Schools had requested a conditional use permit for a small building addition to add a classroom at Concord Elementary School at 5900 Concord Avenue. He said there were no proposed changes to the site plan or parking lot areas and that the addition would match the existing school. He said all setbacks would be met and that parking exceeded code and that since all criteria for a CUP was proposed to be met that staff and the Planning Commission recommended approval. Ms. Kennedy added the addition would be used for special education and additional flexible classroom space. Mayor Hovland opened the public hearing at 7:53 p.m. Public Testimony No one addressed the Council. The Council asked questions and provided feedback. Minutes/Edina City Council/July 19, 2022 Page 4 Member Anderson made a motion, seconded by Member Pierce, to close the public hearing at noon on July 25, 2022, and continue action on Resolution 2022-62, approving a conditional use permit for Concord School at 5900 Benton Avenue, to the August 3, 2022, City Council meeting. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. IX. REPORTS AND RECOMMENDATIONS IX.A. RESOLUTION NO. 2022-63 ACCEPTING DONATIONS – ADOPTED Member Pierce introduced and moved adoption of Resolution No. 2022-63 accepting donations. Member Staunton seconded the motion. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. IX.B. RESOLUTION NO. 2022-65 APPROVING PROPOSED LOCAL SALES TAX QUESTIONS AND AUTHORIZING ELECTION THEREON DURING THE 2022 GENERAL ELECTION – ADOPTED Mr. Neal said Resolution No. 2022-65 approved ballot language for the City’s local option sales tax referendum questions for the 2022 general election. The City was authorized to pose these two ballot questions to Edina voters by an act of the Minnesota State Legislature in 2021. The ballot language had been reviewed by the City Attorney and conformed to the general practices of grammar, syntax and content for local referendum ballot questions. He said if approved by the City Council, the resolution and ballot language would be forwarded to Hennepin County for inclusion on ballots for the 2022 general election, then noted early voting would begin on September 23, 2022. Member Anderson introduced and moved adoption of Resolution No. 2022-65 approving the proposed local sales tax questions and authorizing an election thereon during the 2022 general election. Member Pierce seconded the motion. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. IX.C. ORDINANCE NO. 2022-06; AN INTERIM ORDINANCE PROHIBITING THE SALE, TESTING, MANUFACTURING AND DISTRIBUTION OF THC PRODUCTS – FIRST READING GRANTED Mr. Neal said staff recommended first reading of Ordinance No. 2022-06, an interim ordinance prohibiting the sale, testing, manufacturing, and distribution of THC products. He said the ordinance would impose a one-year moratorium on the retail sales of THC-infused edibles and drinks within the City of Edina. The purpose of the moratorium was to provide sufficient time for staff to study the issues related to the development of a municipal system of regulation and licensure of the retail sales of these materials. He noted a number of Minnesota cities were adopting similar moratoriums for the same or similar purposes and that this ordinance was drafted by the City Attorney and met the standards for municipal moratorium ordinances and would allow staff time to research and recommend an approach for how to address. He said if Ordinance No. 2022-06 was approved on first reading by the City Council at the July 19 Council meeting, staff would schedule second reading for the ordinance at the Council’s August 3 meeting and if approved would become effective immediately. City Attorney Kendall shared how other cities were adopting similar ordinances to allow time to implement regulatory structure to help enforce the regulation of these products. The Council asked questions and provided feedback. Minutes/Edina City Council/July 19, 2022 Page 5 Member Staunton made a motion, seconded by Member Pierce, to grant First Reading of Ordinance No. 2022-06 implementing an interim ordinance prohibiting the sale, testing, manufacturing, and distribution of THC products, and schedule Second Reading at the August 3, 2022 Council meeting. Rollcall: Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. IX.D. RESOLUTION NO. 2022-55 CONDITIONAL USE PERMIT AND VARIANCE FOR INTERLACHEN COUNTRY CLUB, 6200 INTERLACHEN BOULEVARD – ADOPTED Member Pierce stated he would be abstaining from discussion and consideration of this item due to a potential conflict of interest. Mr. Neal confirmed a majority of the remaining members would be required for adoption. Assistant City Planner Bodeker said the Interlachen Country Club was requesting a conditional use permit and building height variance to redevelop some of their existing facilities for its members. The expanded facilities included a new 15,387-square foot lodge/restaurant, a 17,423-square foot fitness center, five outdoor clay tennis courts, two indoor hard surface tennis courts, two pickleball courts and three platform tennis courts. The number of tennis courts was reduced from 9 to 7; the pickleball courts and platform tennis were added. The tennis courts would continue to be used as hockey and skating rinks in the winter and the facilities would be located where the existing racquet courts were on the site today. The covered tennis courts required a structure height variance from 20 feet for non-primary buildings to 39 feet. The existing clubhouse on the site was 52 feet tall and a CUP was required for the new structures proposed. She outlined the public input process and said approval would be based on the proposed findings and conditions. The Council asked questions and provided feedback. Member Staunton introduced and moved adoption of Resolution No. 2022-55 approving a conditional use permit with a height variance for Interlachen Country Club, 6200 Interlachen Boulevard based on the following conditions: 1. The construction plans must be consistent with the proposed development plans, including the landscaping plan date stamped May 12, 2022. 2. Compliance with all the conditions outlined in the city engineer’s memo dated June 6, 2022. 3. Compliance with all the conditions outlined in the building official and fire marshal memo dated June 8, 2022. 4. Hours of operation are limited to the following times: Fitness Center: 5:30 AM – 10:00 PM Food Service: 7:00 AM – 12:00 AM Tennis/Hockey: 7:00 AM – 10:00 PM Member Anderson seconded the motion. Rollcall: Ayes: Anderson, Staunton, and Hovland. Abstain: Pierce Motion carried. IX.E. ORDINANCE NO. 2022-07 OFF-STREET PARKING REGULATIONS – POSTPONED TO AUGUST 3, 2022 Item was postponed to August 3, 2022. IX.F. SKETCH PLAN FOR LIFE TIME LIVING AT SOUTHDALE – REVIEWED Minutes/Edina City Council/July 19, 2022 Page 6 Mr. Teague said the applicants, Life Time and Simon Property group, were proposing a 300-unit, 32-story residential building. The site would be accessed from the mall property by the ring road and require the relocation of the bus transit station to the north side of the mall property. The building would be set back approximately 140 feet from the curb of York Avenue. The apartment building would be connected to Life Time Fitness by a skyway located on the third level and any approval would require site plan review and a building height variance as any structure adjacent to R-1 properties higher than nine stories required a setback six times the height of building or 2,400 feet. He outlined the proposed parking stall variance and said a traffic and parking study would be required should the project move forward. Eric Padget, Life Time, shared about the proposed project that would add to the continued success in the Southdale through their renovation of the former JC Penney into Life Time that would redefine Southdale Mall. He spoke about their partnership with Simon Property to deliver a health/wellness destination through a for-lease apartment home designed in a health-forward way that would include concierge wellness, technology. He spoke about major site improvements and creation of a major grid network, modified two- way ring road, public park and open greenspace, and relocation of bus transit station. He said they would place a high priority on the creation of a public realm and greenspace through a pocket park of 1.5 acres of new greenspace that would be activated and programmed and publicly accessible but privately maintained. Mr. Padget said this project would provide the creation of a new gateway into Southdale Mall then outlined the 300 units, 32-stories, 450 parking stalls of which 85 would be publicly-accessible for mall use, 65 stalls internal to the parking podium, and improved pedestrian access in and around the site. Christine Pecard, ESG Architects, shared more about the proposed design concepts and existing site conditions that were hardscaped with underutilized parking areas. She outlined the proposed landscaping, grade changes, and canted building shape that while not efficient for development was essential to respond to existing site conditions as it provided more greenspace and active walk-up units on the outward façade. She reviewed the proposed grid modifications with passive connections, reviewed the proposed high quality materials, and prioritized the pedestrian street that would create separation from the front yard while providing privacy for the walk-up units. Ms. Pecard spoke about the woonerf area for large gatherings and activities for public and Life Time, a transparent building with lots of glass, architectural fins and accent metal panels, a sky room and outdoor terrace, then reviewed the requests for height and setback variances and provided a shadow study to show minimal impacts to surrounding residential areas. She spoke about the new 1.5 acres of public greenspace with amenities such as pickleball courts and a dog park and said the Southdale District guidelines called for a park which had York Avenue as a good location for entry. She noted this was not an inward development but phase two of a horizonal mixed use development and that the proposed 300 units of density would be a catalyst for next phase development and would allow Simon Property to redevelop other parcels and encouraged development to the west and north. The Council asked questions and provided feedback. X. COMMISSION CORRESPONDENCE (MINUTES AND ADVISORY COMMUNICATION) – Received X.A. MINUTES: TRANSPORTATION COMMISSION, MAY 19, 2022 X.B. MINUTES: HUMAN RIGHTS AND RELATIONS COMMISSION, APRIL 26 AND MAY 24, 2022 X.C. ADVISORY COMMUNICATION: COMMUNITY HEALTH COMMISSION: SOCIAL CONNECTEDNESS INITIATIVE AND VITALS APPLICATION X.D. ADVISORY COMMUNICATION: ARTS AND CULTURE COMMISSION: NEW ARTS CENTER XI. MANAGER’S COMMENTS – Received XI.A. PREP MEMO FOR JULY 19, 2022 XII. MAYOR AND COUNCIL COMMENTS – Received XIII. ADJOURNMENT Minutes/Edina City Council/July 19, 2022 Page 7 Member Pierce made a motion, seconded by Member Anderson, to adjourn the meeting at 9:41 p.m. Ayes: Anderson, Pierce, Staunton, and Hovland. Motion carried. Respectfully submitted, Sharon Allison, City Clerk Minutes approved by Edina City Council, August 3, 2022. James B. Hovland, Mayor Video Copy of the July 19, 2022, meeting available. Date: August 3, 2022 Agenda Item #: VI.B. To:Mayor and City Council Item Type: Claims From:Alisha McAndrews, Finance Director Item Activity: Subject:Approve Payment of Claims Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve claims for payment: Check Register Claims Pre-List Dated 7.22.22 TOTAL $1,465,910.81 INTRODUCTION: Claims information for approval is attached. ATTACHMENTS: Description Check Register Claims Pre-List Dated 7.22.22 TOTAL $1,465,910.81 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 53 JOURNAL ENTRIES TO BE CREATED FUND SUB FUND DUE TO DUE FR 1000 General 176,859.402100 Police Special Revenue 418.952100 Police Special Revenue 1,890.002300 Pedestrian and Cyclist Safety 12,540.333000 Debt Service 400.003000 Debt Service 400.003000 Debt Service 400.003000 Debt Service 400.003000 Debt Service 400.004000 Capital Projects 16,329.284200 Equipment Replacement 1,200.004400 PIR Capital Projects 181,616.955100 Art Center 178.025200 Braemar Golf Course 22,720.855200 Braemar Golf Course 10,675.035300 Aquatic Center 6,072.315400 Edinborough Park 7,289.555500 Braemar Arena 42,964.355700 Centennial Lakes 9,029.925800 Liquor 96,339.235900 Utility Fund 131,179.425900 Utility Fund 20,275.535900 Utility Fund 188,368.945900 Utility Fund 46,210.396000 Risk Management 27,221.556100 Equipment Operations 22,099.256200 Information Technology 4,667.256300 Facilities Management 2,877.317100 PS Training Facility 4,678.597200 MN Task Force 1 138.749000 Payroll 430,069.679999 Pooled Cash Fund 1,465,910.81 TOTAL 1,465,910.81 1,465,910.81 ** END OF REPORT - Generated by Shirleng Tan Geil ** City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 1 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474070 07/22/2022 PRTD 101304 ABM EQUIPMENT & SUPPLY 0171304-IN 06/24/2022 20220722 90.98 ABM EQUIPMENT & SUPPLY 0171305-IN 06/24/2022 20220722 146.16 CHECK 474070 TOTAL: 237.14 474071 07/22/2022 PRTD 129458 ACME ELECTRIC MOTOR INC 10093039 06/23/2022 20220722 448.99 ACME ELECTRIC MOTOR INC 10093050 06/23/2022 20220722 84.00 CHECK 474071 TOTAL: 532.99 474072 07/22/2022 PRTD 135922 ACUSHNET COMPANY 913517469 06/13/2022 20220722 39.67 ACUSHNET COMPANY 913678888 07/02/2022 20220722 114.57 CHECK 474072 TOTAL: 154.24 474073 07/22/2022 PRTD 133504 AID ELECTRIC CORPORATION 70080 06/24/2022 20220722 1,064.00 CHECK 474073 TOTAL: 1,064.00 474074 07/22/2022 PRTD 130792 AIRGAS NATIONAL CARBONATION 9127272562 06/25/2022 20220722 304.50 CHECK 474074 TOTAL: 304.50 474075 07/22/2022 PRTD 103357 ALPHA VIDEO & AUDIO INC 11723 06/27/2022 20220722 1,200.00 CHECK 474075 TOTAL: 1,200.00 474076 07/22/2022 PRTD 160287 AMAZING ATHLETES OF CENTRAL MN 9391 06/27/2022 20220722 784.00 CHECK 474076 TOTAL: 784.00 474077 07/22/2022 PRTD 141960 AMAZON CAPITAL SERVICES 1HTJ-JVYQ-9KQQ 06/21/2022 20220722 93.02 AMAZON CAPITAL SERVICES 1LMW-N1CJ-FRC9 06/22/2022 20220722 218.88 AMAZON CAPITAL SERVICES 1FL9-TVCL-HRXG 06/22/2022 20220722 24.99 AMAZON CAPITAL SERVICES 1CQ4-XR4T-JNQN 06/22/2022 20220722 83.88 AMAZON CAPITAL SERVICES 1NY4-HQPW-L639 06/22/2022 20220722 38.00 AMAZON CAPITAL SERVICES 1YDX-WXTW-MDV6 06/22/2022 20220722 12.99 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 2 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET AMAZON CAPITAL SERVICES 1DPP-JVD4-N1Y1 06/23/2022 20220722 54.99 AMAZON CAPITAL SERVICES 1WPC-P91Q-MKVT 06/23/2022 20220722 284.87 AMAZON CAPITAL SERVICES 19MW-HQYC-NMNT 06/23/2022 20220722 10.79 AMAZON CAPITAL SERVICES 13XQ-GT4N-3HXP 06/23/2022 20220722 35.50 AMAZON CAPITAL SERVICES 11QG-M6L1-3PQK 06/23/2022 20220722 27.97 AMAZON CAPITAL SERVICES 1GGR-XVMF-4HJG 06/23/2022 20220722 40.62 AMAZON CAPITAL SERVICES 11YH-WL1W-3C4X 06/23/2022 20220722 11.60 AMAZON CAPITAL SERVICES 1D11-3QTR-CH7D 06/24/2022 20220722 415.68 AMAZON CAPITAL SERVICES 11YH-WL1W-FLHG 06/25/2022 20220722 35.79 AMAZON CAPITAL SERVICES 197F-D9XM-J39K 06/25/2022 20220722 20.29 AMAZON CAPITAL SERVICES 1HWV-CNQK-J9G1 06/25/2022 20220722 43.92 AMAZON CAPITAL SERVICES 1HJD-CTFW-JGGK 06/25/2022 20220722 138.16 AMAZON CAPITAL SERVICES 1DPX-PDTL-K3YL 06/25/2022 20220722 22.50 AMAZON CAPITAL SERVICES 11P6-LQYV-LFFR 06/26/2022 20220722 40.49 AMAZON CAPITAL SERVICES 16HD-VW4J-VMCR 06/27/2022 20220722 890.00 AMAZON CAPITAL SERVICES 1HVQ-KLKW-YXPH 06/27/2022 20220722 23.96 AMAZON CAPITAL SERVICES 19XW-4VJ3-61KT 06/27/2022 20220722 317.54 AMAZON CAPITAL SERVICES 1QKW-JLY3-77CX 06/27/2022 20220722 30.00 AMAZON CAPITAL SERVICES 1QPR-XFCW-74L3 06/27/2022 20220722 7.99 AMAZON CAPITAL SERVICES 1XRX-PN6M-NK7P 07/13/2022 20220722 49.33 CHECK 474077 TOTAL: 2,973.75 474078 07/22/2022 PRTD 101874 ANCOM TECHNICAL CENTER 108831 06/22/2022 20220722 1,393.00 CHECK 474078 TOTAL: 1,393.00 474079 07/22/2022 PRTD 141691 ANDERSON, WENDY S 15 06/24/2022 20220722 1,600.20 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 3 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474079 TOTAL: 1,600.20 474080 07/22/2022 PRTD 160450 AMERICAN PUBLIC WORKS ASSOCIATION 612495-04/2022 04/04/2022 20220722 2,312.50 CHECK 474080 TOTAL: 2,312.50 474081 07/22/2022 PRTD 100632 AQUA ENGINEERING INC 107235 06/22/2022 20220722 3,282.70 AQUA ENGINEERING INC 107581 06/23/2022 20220722 1,785.50 CHECK 474081 TOTAL: 5,068.20 474082 07/22/2022 PRTD 151441 ARAMARK UNIFORM AND CAREER APPEAL 2500037709 06/22/2022 20220722 341.21 CHECK 474082 TOTAL: 341.21 474083 07/22/2022 PRTD 102012 ARMENIAN CULTURAL ORGANIZATION OF 22CLP0054 07/20/2022 20220722 150.00 CHECK 474083 TOTAL: 150.00 474084 07/22/2022 PRTD 106304 ASPEN MILLS INC 296044 06/24/2022 20220722 95.10 ASPEN MILLS INC 296065 06/24/2022 20220722 28.50 ASPEN MILLS INC 296064 06/24/2022 20220722 28.50 ASPEN MILLS INC 296062 06/24/2022 20220722 28.50 ASPEN MILLS INC 296052 06/24/2022 20220722 79.99 ASPEN MILLS INC 296053 06/24/2022 20220722 113.89 ASPEN MILLS INC 296054 06/24/2022 20220722 113.89 CHECK 474084 TOTAL: 488.37 474085 07/22/2022 PRTD 160447 AUDIO LOGIC PRO SOUND COMPANY LLC 14398 05/20/2022 20220722 598.00 CHECK 474085 TOTAL: 598.00 474086 07/22/2022 PRTD 133689 AUER STEEL HEATING & SUPPLY COMPA 31332848 07/06/2022 20220722 103.75 CHECK 474086 TOTAL: 103.75 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 4 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474087 07/22/2022 PRTD 101718 IEH AUTO PARTS LLC 380111874 06/23/2022 20220722 57.66 IEH AUTO PARTS LLC 380111848 06/23/2022 20220722 44.88 CHECK 474087 TOTAL: 102.54 474088 07/22/2022 PRTD 141881 FIDELITY SECURITY LIFE 2883156 06/24/2022 20220722 983.78 CHECK 474088 TOTAL: 983.78 474089 07/22/2022 PRTD 101355 BELLBOY CORPORATION 0105369200 06/30/2022 20220722 30.13 BELLBOY CORPORATION 0095481800 06/30/2022 20220722 1,467.83 BELLBOY CORPORATION 0095563500 07/01/2022 20220722 344.90 BELLBOY CORPORATION 0095484600 06/30/2022 20220722 97.65 BELLBOY CORPORATION 0105377000 06/30/2022 20220722 198.50 BELLBOY CORPORATION 0095503100 06/30/2022 20220722 1,791.73 CHECK 474089 TOTAL: 3,930.74 474090 07/22/2022 PRTD 131191 BERNATELLO'S PIZZA INC 5076070 06/21/2022 20220722 624.00 BERNATELLO'S PIZZA INC 5076965 06/24/2022 20220722 1,170.00 CHECK 474090 TOTAL: 1,794.00 474091 07/22/2022 PRTD 100653 BITUMINOUS ROADWAYS INC 15955 06/21/2022 22200014 20220722 46,960.94 CHECK 474091 TOTAL: 46,960.94 474092 07/22/2022 PRTD 142153 BLACK STACK BREWING INC 18207 06/30/2022 20220722 144.00 BLACK STACK BREWING INC 18206 06/30/2022 20220722 288.00 CHECK 474092 TOTAL: 432.00 474093 07/22/2022 PRTD 132444 BOLTON & MENK INC 0291840 06/23/2022 20220722 1,600.00 CHECK 474093 TOTAL: 1,600.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 5 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474094 07/22/2022 PRTD 105367 BOUND TREE MEDICAL LLC 84570728 06/21/2022 20220722 501.03 BOUND TREE MEDICAL LLC 84570729 06/21/2022 20220722 313.28 CHECK 474094 TOTAL: 814.31 474095 07/22/2022 PRTD 117040 BOYER FORD TRUCKS INC 008P11700 06/21/2022 20220722 98.69 BOYER FORD TRUCKS INC 008P11710 06/21/2022 20220722 98.69 BOYER FORD TRUCKS INC 008P11720 06/21/2022 20220722 -98.69 CHECK 474095 TOTAL: 98.69 474096 07/22/2022 PRTD 124291 BREAKTHRU BEVERAGE MINNESOTA WINE 344711154 06/30/2022 20220722 169.15 BREAKTHRU BEVERAGE MINNESOTA WINE 344711155 06/30/2022 20220722 2,565.12 BREAKTHRU BEVERAGE MINNESOTA WINE 344779010 07/06/2022 20220722 2,908.70 CHECK 474096 TOTAL: 5,642.97 474097 07/22/2022 PRTD 124529 BREAKTHRU BEVERAGE MINNESOTA BEER 344685502 06/28/2022 20220722 5,056.95 BREAKTHRU BEVERAGE MINNESOTA BEER 344685500 06/30/2022 20220722 255.70 BREAKTHRU BEVERAGE MINNESOTA BEER 344685840 06/30/2022 20220722 3,664.50 BREAKTHRU BEVERAGE MINNESOTA BEER 344685501 06/30/2022 20220722 101.55 CHECK 474097 TOTAL: 9,078.70 474098 07/22/2022 PRTD 130485 BRUESKE, TARA 22CLP0050 07/20/2022 20220722 200.00 CHECK 474098 TOTAL: 200.00 474099 07/22/2022 PRTD 130485 BRUESKE, TARA 22CLP0066 07/20/2022 20220722 200.00 CHECK 474099 TOTAL: 200.00 474100 07/22/2022 PRTD 130485 BRUESKE, TARA 22CLP0071 07/20/2022 20220722 200.00 CHECK 474100 TOTAL: 200.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 6 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474101 07/22/2022 PRTD 130485 BRUESKE, TARA 22CLP0072 07/20/2022 20220722 200.00 CHECK 474101 TOTAL: 200.00 474102 07/22/2022 PRTD 103244 BURTIS, ROBERT 22CLP0063 07/20/2022 20220722 250.00 CHECK 474102 TOTAL: 250.00 474103 07/22/2022 PRTD 100648 BERTELSON BROTHERS INC WO-1192738-1 06/24/2022 20220722 179.15 BERTELSON BROTHERS INC WO-1192947-1 06/27/2022 20220722 81.89 CHECK 474103 TOTAL: 261.04 474104 07/22/2022 PRTD 138462 CAGLEY, WILLIAM J 22CLP0055 07/20/2022 20220722 200.00 CAGLEY, WILLIAM J 22CLP0073 07/20/2022 20220722 200.00 CHECK 474104 TOTAL: 400.00 474105 07/22/2022 PRTD 102149 CALLAWAY GOLF 934583495 04/02/2022 20220722 346.50 CHECK 474105 TOTAL: 346.50 474106 07/22/2022 PRTD 120935 CAMPBELL KNUTSON PA 05-2022-2851 05/31/2022 20220722 23,136.74 CHECK 474106 TOTAL: 23,136.74 474107 07/22/2022 PRTD 119455 CAPITOL BEVERAGE SALES LP 2707356 07/01/2022 20220722 25.49 CAPITOL BEVERAGE SALES LP 2707357 07/01/2022 20220722 228.50 CAPITOL BEVERAGE SALES LP 2707360 07/01/2022 20220722 5,386.30 CAPITOL BEVERAGE SALES LP 2707359 07/01/2022 20220722 1,350.00 CAPITOL BEVERAGE SALES LP 2707647 07/05/2022 20220722 2,603.05 CAPITOL BEVERAGE SALES LP 2707645 07/05/2022 20220722 1,350.00 CAPITOL BEVERAGE SALES LP 2707646 07/05/2022 20220722 90.73 CHECK 474107 TOTAL: 11,034.07 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 7 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474108 07/22/2022 PRTD 137524 CAPRI BIG BAND 22CLP0068 07/20/2022 20220722 150.00 CHECK 474108 TOTAL: 150.00 474109 07/22/2022 PRTD 101515 CEMSTONE PRODUCTS COMPANY C2520318 06/27/2022 20220722 956.00 CHECK 474109 TOTAL: 956.00 474110 07/22/2022 PRTD 160160 CHRISTIANSON'S BUSINESS FURNITURE 6642-1-KR 06/22/2022 20220722 1,794.00 CHRISTIANSON'S BUSINESS FURNITURE 6717-1-KR 06/22/2022 20220722 1,600.00 CHECK 474110 TOTAL: 3,394.00 474111 07/22/2022 PRTD 142028 CINTAS CORPORATION 4123514581 06/27/2022 20220722 16.32 CINTAS CORPORATION 4123514580 06/27/2022 20220722 87.50 CINTAS CORPORATION 4123514233 06/27/2022 20220722 27.65 CINTAS CORPORATION 4123514193 06/27/2022 20220722 33.63 CINTAS CORPORATION 4123514096 06/27/2022 20220722 11.78 CINTAS CORPORATION 4123514238 06/27/2022 20220722 32.88 CINTAS CORPORATION 4123514195 06/27/2022 20220722 17.87 CHECK 474111 TOTAL: 227.63 474112 07/22/2022 PRTD 101837 COMMUNICATIONS COM-2655 07/12/2022 20220722 100.00 CHECK 474112 TOTAL: 100.00 474113 07/22/2022 PRTD 101837 COMMUNICATIONS COM-2646 06/12/2022 20220722 100.00 CHECK 474113 TOTAL: 100.00 474114 07/22/2022 PRTD 103216 MINNEAPOLIS FINANCE DEPARTMENT 431-0005.300-06/22 07/06/2022 20220722 26,168.32 CHECK 474114 TOTAL: 26,168.32 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 8 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474115 07/22/2022 PRTD 105696 CITY-COUNTY COMMUNICATIONS & MARK INV-2762 07/19/2022 20220722 720.00 CHECK 474115 TOTAL: 720.00 474116 07/22/2022 PRTD 102165 ROGER CLEVELAND GOLF CO. INC 7035932 SO 06/23/2022 20220722 2,304.00 CHECK 474116 TOTAL: 2,304.00 474117 07/22/2022 PRTD 120433 COMCAST 0007539-07/22 07/08/2022 20220722 924.93 CHECK 474117 TOTAL: 924.93 474118 07/22/2022 PRTD 141193 COMMERCIAL STEAM TEAM INC 24638 06/01/2022 20220722 450.00 CHECK 474118 TOTAL: 450.00 474119 07/22/2022 PRTD 137199 COVERTTRACK GROUP INC 50342 06/23/2022 20220722 600.00 CHECK 474119 TOTAL: 600.00 474120 07/22/2022 PRTD 101403 CRYSTEEL MANUFACTURING INC LC00077915 06/27/2022 20220722 592.25 CHECK 474120 TOTAL: 592.25 474121 07/22/2022 PRTD 100699 CULLIGAN SOFTWATER SERVICE COMPAN 114X86927502 06/30/2022 20220722 130.69 CHECK 474121 TOTAL: 130.69 474122 07/22/2022 PRTD 104020 DALCO ENTERPRISES INC 3950103 06/21/2022 20220722 51.15 DALCO ENTERPRISES INC 3950206 06/21/2022 20220722 406.00 DALCO ENTERPRISES INC 3950825 06/22/2022 20220722 1,167.90 CHECK 474122 TOTAL: 1,625.05 474123 07/22/2022 PRTD 102195 DAY INVESTMENTS LLC P52656695 06/24/2022 20220722 95.08 CHECK 474123 TOTAL: 95.08 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 9 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474124 07/22/2022 PRTD 121103 DIRECTV GROUP INC 016523692X220713 07/13/2022 20220722 146.08 CHECK 474124 TOTAL: 146.08 474125 07/22/2022 PRTD 160459 DOUGLAS HARVEY AND ASSOCIATES 22CLP0048 07/20/2022 20220722 150.00 CHECK 474125 TOTAL: 150.00 474126 07/22/2022 PRTD 132810 ECM PUBLISHERS INC 899012 06/23/2022 20220722 192.55 CHECK 474126 TOTAL: 192.55 474127 07/22/2022 PRTD 103594 EDINALARM INC 78662 07/01/2022 20220722 225.80 CHECK 474127 TOTAL: 225.80 474128 07/22/2022 PRTD 100146 ELLIOTT AUTO SUPPLY CO, INC 1-7718347 06/21/2022 20220722 37.04 ELLIOTT AUTO SUPPLY CO, INC 69-454252 06/22/2022 20220722 101.59 ELLIOTT AUTO SUPPLY CO, INC 1-7723146 06/22/2022 20220722 8.33 ELLIOTT AUTO SUPPLY CO, INC 1-7725451 06/23/2022 20220722 49.26 ELLIOTT AUTO SUPPLY CO, INC 69-454330 06/23/2022 20220722 45.16 ELLIOTT AUTO SUPPLY CO, INC 1-7789519 07/15/2022 20220722 -80.00 CHECK 474128 TOTAL: 161.38 474129 07/22/2022 PRTD 147181 FALLING BREWERY - BERGMAN LEDGE L E-6943 06/30/2022 20220722 141.00 FALLING BREWERY - BERGMAN LEDGE L E-6944 06/30/2022 20220722 342.00 CHECK 474129 TOTAL: 483.00 474130 07/22/2022 PRTD 103600 FERGUSON US HOLDINGS INC 0496057 06/21/2022 20220722 9,573.66 CHECK 474130 TOTAL: 9,573.66 474131 07/22/2022 PRTD 160061 FILTER BREWING COMPANY LLC PLATO 1620 06/30/2022 20220722 65.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 10 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474131 TOTAL: 65.00 474132 07/22/2022 PRTD 116189 FILTRATION SYSTEMS INC 107887 06/27/2022 20220722 1,542.47 CHECK 474132 TOTAL: 1,542.47 474133 07/22/2022 PRTD 141837 DAIOHS USA INC 617002 06/21/2022 20220722 303.14 DAIOHS USA INC 808594 06/22/2022 20220722 567.48 DAIOHS USA INC 602653 03/28/2022 20220722 168.95 DAIOHS USA INC 808571 04/28/2022 20220722 425.00 CHECK 474133 TOTAL: 1,464.57 474134 07/22/2022 PRTD 102727 FORCE AMERICA DISTRIBUTING LLC 001-1647950 06/27/2022 20220722 22.77 CHECK 474134 TOTAL: 22.77 474135 07/22/2022 PRTD 160384 FRESCO INC 65987 06/24/2022 20220722 6,340.00 CHECK 474135 TOTAL: 6,340.00 474136 07/22/2022 PRTD 102456 GALLS PARENT HOLDINGS LLC BC1647195 06/22/2022 20220722 158.00 GALLS PARENT HOLDINGS LLC BC1647607 06/23/2022 20220722 137.86 GALLS PARENT HOLDINGS LLC BC1650336 06/27/2022 20220722 126.54 CHECK 474136 TOTAL: 422.40 474137 07/22/2022 PRTD 160159 GARB ALTERNATIVE SPORTSWEAR INC 151791 06/23/2022 20220722 40.83 CHECK 474137 TOTAL: 40.83 474138 07/22/2022 PRTD 101103 WW GRAINGER 9355223158 06/23/2022 20220722 129.32 WW GRAINGER 9355223166 06/23/2022 20220722 149.16 CHECK 474138 TOTAL: 278.48 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 11 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474139 07/22/2022 PRTD 100790 HACH COMPANY 13109884 06/22/2022 20220722 285.48 HACH COMPANY 13105923 06/21/2022 20220722 570.96 CHECK 474139 TOTAL: 856.44 474140 07/22/2022 PRTD 102426 HALE, WILLIAM 22CLP0069 07/20/2022 20220722 250.00 CHECK 474140 TOTAL: 250.00 474141 07/22/2022 PRTD 151168 HAMMER SPORTS LLC 2362 06/26/2022 20220722 454.00 CHECK 474141 TOTAL: 454.00 474142 07/22/2022 PRTD 100797 HAWKINS INC 6222227 06/27/2022 20220722 19,914.53 CHECK 474142 TOTAL: 19,914.53 474143 07/22/2022 PRTD 100798 HAYDEN-MURPHY EQUIPMENT COMPANY R0206201 06/21/2022 20220722 2,700.00 CHECK 474143 TOTAL: 2,700.00 474144 07/22/2022 PRTD 122093 GROUP HEALTHPLAN INC 113374906 06/24/2022 20220722 429,085.89 GROUP HEALTHPLAN INC 113351462 06/24/2022 20220722 25,164.85 CHECK 474144 TOTAL: 454,250.74 474145 07/22/2022 PRTD 102079 HIGHVIEW PLUMBING INC 16550 06/24/2022 20220722 6,270.00 HIGHVIEW PLUMBING INC 16551 06/24/2022 20220722 3,778.52 CHECK 474145 TOTAL: 10,048.52 474146 07/22/2022 PRTD 144652 HINDING, CHRISTIAN 22CLP0060 07/20/2022 20220722 250.00 CHECK 474146 TOTAL: 250.00 474147 07/22/2022 PRTD 104375 HOHENSTEINS INC 519456 07/05/2022 20220722 127.50 HOHENSTEINS INC 519457 07/05/2022 20220722 247.50 HOHENSTEINS INC 519455 07/05/2022 20220722 3,237.40 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 12 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET HOHENSTEINS INC 519445 07/05/2022 20220722 247.50 HOHENSTEINS INC 519447 07/05/2022 20220722 687.60 HOHENSTEINS INC 519446 07/05/2022 20220722 111.00 CHECK 474147 TOTAL: 4,658.50 474148 07/22/2022 PRTD 160179 HOLM, CHRISTOPHER 22CLP0067 07/20/2022 20220722 150.00 CHECK 474148 TOTAL: 150.00 474149 07/22/2022 PRTD 100417 HORIZON CHEMICAL CO INV19150 06/22/2022 20220722 355.16 HORIZON CHEMICAL CO INV19265 06/21/2022 20220722 132.54 CHECK 474149 TOTAL: 487.70 474150 07/22/2022 PRTD 101714 IDENTISYS INCORPORATED 575760 06/27/2022 20220722 182.72 CHECK 474150 TOTAL: 182.72 474151 07/22/2022 PRTD 100814 INDELCO PLASTICS CORPORATION INV335101 06/23/2022 20220722 203.94 CHECK 474151 TOTAL: 203.94 474152 07/22/2022 PRTD 146407 INGCO INTERNATIONAL 602134 06/27/2022 20220722 5,500.00 CHECK 474152 TOTAL: 5,500.00 474153 07/22/2022 PRTD 127002 DEPARTMENT OF THE TREASURY 2022-Q2-720V 07/15/2022 20220722 209.25 CHECK 474153 TOTAL: 209.25 474154 07/22/2022 PRTD 100828 JERRY'S ENTERPRISES INC AQUA-06/2022 06/25/2022 20220722 8.96 JERRY'S ENTERPRISES INC ITS-06/2022 06/25/2022 20220722 30.12 CHECK 474154 TOTAL: 39.08 474155 07/22/2022 PRTD 100835 ARTISAN BEER COMPANY 3544859 06/30/2022 20220722 886.10 ARTISAN BEER COMPANY 3544860 06/30/2022 20220722 104.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 13 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474155 TOTAL: 990.10 474156 07/22/2022 PRTD 100835 PHILLIPS WINE & SPIRITS 6422105 06/30/2022 20220722 712.18 PHILLIPS WINE & SPIRITS 6422106 06/30/2022 20220722 512.24 PHILLIPS WINE & SPIRITS 6422107 06/30/2022 20220722 166.85 PHILLIPS WINE & SPIRITS 6422108 06/30/2022 20220722 688.50 PHILLIPS WINE & SPIRITS 6422118 06/30/2022 20220722 688.50 PHILLIPS WINE & SPIRITS 6422119 06/30/2022 20220722 1,092.69 PHILLIPS WINE & SPIRITS 6422120 06/30/2022 20220722 403.87 PHILLIPS WINE & SPIRITS 6422117 06/30/2022 20220722 1,033.56 CHECK 474156 TOTAL: 5,298.39 474157 07/22/2022 PRTD 100835 WINE MERCHANTS 7385778 06/30/2022 20220722 1,842.22 WINE MERCHANTS 7385779 06/30/2022 20220722 1,456.21 WINE MERCHANTS 7386030 06/30/2022 20220722 825.45 WINE MERCHANTS 7385781 06/30/2022 20220722 2,501.60 CHECK 474157 TOTAL: 6,625.48 474158 07/22/2022 PRTD 100835 JOHNSON BROTHERS LIQUOR CO 2084951 06/30/2022 20220722 336.71 JOHNSON BROTHERS LIQUOR CO 2084950 06/30/2022 20220722 565.72 JOHNSON BROTHERS LIQUOR CO 2084955 06/30/2022 20220722 231.40 JOHNSON BROTHERS LIQUOR CO 2084956 06/30/2022 20220722 719.97 JOHNSON BROTHERS LIQUOR CO 2084957 06/30/2022 20220722 133.35 JOHNSON BROTHERS LIQUOR CO 2084958 06/30/2022 20220722 2,796.67 JOHNSON BROTHERS LIQUOR CO 2084960 06/30/2022 20220722 394.44 JOHNSON BROTHERS LIQUOR CO 2084954 06/30/2022 20220722 350.13 JOHNSON BROTHERS LIQUOR CO 2086309 06/30/2022 20220722 1,966.20 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 14 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET JOHNSON BROTHERS LIQUOR CO 2086308 07/01/2022 20220722 1,966.20 JOHNSON BROTHERS LIQUOR CO 2084981 06/30/2022 20220722 394.20 JOHNSON BROTHERS LIQUOR CO 2084959 06/30/2022 20220722 2.70 JOHNSON BROTHERS LIQUOR CO 2084979 06/30/2022 20220722 6,422.43 JOHNSON BROTHERS LIQUOR CO 2084978 06/30/2022 20220722 180.31 JOHNSON BROTHERS LIQUOR CO 2084980 06/30/2022 20220722 500.80 JOHNSON BROTHERS LIQUOR CO 2084977 06/30/2022 20220722 523.31 JOHNSON BROTHERS LIQUOR CO 2084953 06/30/2022 20220722 66.70 JOHNSON BROTHERS LIQUOR CO 2084952 06/30/2022 20220722 479.06 JOHNSON BROTHERS LIQUOR CO 2084962 06/30/2022 20220722 .23 JOHNSON BROTHERS LIQUOR CO 2084976 06/30/2022 20220722 868.58 JOHNSON BROTHERS LIQUOR CO 2084975 06/30/2022 20220722 644.08 CHECK 474158 TOTAL: 19,543.19 474159 07/22/2022 PRTD 141864 JOSEPH E JOHNSON & SONS CONSTRUCT 1154 06/22/2022 20220722 10,318.99 CHECK 474159 TOTAL: 10,318.99 474160 07/22/2022 PRTD 145396 JUNKYARD BREWING COMPANY LLC 004314 07/01/2022 20220722 444.00 JUNKYARD BREWING COMPANY LLC 004315 07/01/2022 20220722 222.00 JUNKYARD BREWING COMPANY LLC 004316 07/01/2022 20220722 222.00 CHECK 474160 TOTAL: 888.00 474161 07/22/2022 PRTD 103409 KELBRO COMPANY 2778714 06/30/2022 20220722 112.45 KELBRO COMPANY 2780617 06/28/2022 20220722 -30.80 KELBRO COMPANY 2778631 06/30/2022 20220722 226.70 KELBRO COMPANY 2780371 07/02/2022 20220722 93.85 CHECK 474161 TOTAL: 402.20 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 15 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474162 07/22/2022 PRTD 137525 KERNS, JOHN 22CLP0058 07/20/2022 20220722 250.00 CHECK 474162 TOTAL: 250.00 474163 07/22/2022 PRTD 100944 KIWI KAI IMPORTS INC 169994 06/30/2022 20220722 1,540.00 CHECK 474163 TOTAL: 1,540.00 474164 07/22/2022 PRTD 116776 JASPERSEN ENTERPRISES INC 89463 06/06/2022 20220722 115.00 CHECK 474164 TOTAL: 115.00 474165 07/22/2022 PRTD 143544 LADY A LITERARY 67 06/27/2022 20220722 6,662.00 CHECK 474165 TOTAL: 6,662.00 474166 07/22/2022 PRTD 139451 LANDBRIDGE ECOLOGICAL INC 1145 06/27/2022 20220722 400.00 CHECK 474166 TOTAL: 400.00 474167 07/22/2022 PRTD 100852 LAWSON PRODUCTS INC 9309691166 06/24/2022 20220722 784.19 CHECK 474167 TOTAL: 784.19 474168 07/22/2022 PRTD 101552 LEAGUE OF MINNESOTA CITIES 18890 05/01/2022 20220722 681.58 LEAGUE OF MINNESOTA CITIES 18969 05/01/2022 20220722 213.46 LEAGUE OF MINNESOTA CITIES 18956 05/01/2022 20220722 751.14 LEAGUE OF MINNESOTA CITIES 18959 05/01/2022 20220722 120.21 LEAGUE OF MINNESOTA CITIES 18944 05/01/2022 20220722 8.31 CHECK 474168 TOTAL: 1,774.70 474169 07/22/2022 PRTD 102125 LESSMAN, GREG J 73888 06/27/2022 20220722 1,350.98 CHECK 474169 TOTAL: 1,350.98 474170 07/22/2022 PRTD 160456 LOR, HILLARY 22CLP0057 07/20/2022 20220722 150.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 16 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474170 TOTAL: 150.00 474171 07/22/2022 PRTD 102722 PEAVEY CORPORATION 390979 06/22/2022 20220722 353.37 CHECK 474171 TOTAL: 353.37 474172 07/22/2022 PRTD 134063 MANSFIELD OIL COMPANY 23382215 06/27/2022 20220722 11,990.39 MANSFIELD OIL COMPANY CM-202092 07/12/2022 20220722 -569.16 CHECK 474172 TOTAL: 11,421.23 474173 07/22/2022 PRTD 122554 MATHESON TRI-GAS INC 0025740754 05/31/2022 20220722 114.80 MATHESON TRI-GAS INC 0025866094 06/24/2022 20220722 373.18 CHECK 474173 TOTAL: 487.98 474174 07/22/2022 PRTD 141215 MAVERICK WINE LLC INV802144 07/05/2022 20220722 133.50 CHECK 474174 TOTAL: 133.50 474175 07/22/2022 PRTD 105603 MEDICINE LAKE TOURS 07-20-2022 07/07/2022 20220722 2,288.00 CHECK 474175 TOTAL: 2,288.00 474176 07/22/2022 PRTD 101483 MENARDS 63961 06/27/2022 20220722 35.76 MENARDS 63646 06/22/2022 20220722 40.08 MENARDS 63649 06/22/2022 20220722 129.42 MENARDS 60598 05/04/2022 20220722 14.73 CHECK 474176 TOTAL: 219.99 474177 07/22/2022 PRTD 100885 METRO SALES INC INV2071049 06/23/2022 20220722 3,639.43 CHECK 474177 TOTAL: 3,639.43 474178 07/22/2022 PRTD 102729 METROPOLITAN FORD LLC 528549 06/23/2022 20220722 97.20 METROPOLITAN FORD LLC 528541 06/22/2022 20220722 88.04 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 17 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474178 TOTAL: 185.24 474179 07/22/2022 PRTD 104650 MICRO CENTER 9257878 06/24/2022 20220722 271.93 CHECK 474179 TOTAL: 271.93 474180 07/22/2022 PRTD 101161 MIDWEST CHEMICAL SUPPLY INC 44346 06/21/2022 20220722 560.65 MIDWEST CHEMICAL SUPPLY INC 44347 06/21/2022 20220722 198.00 CHECK 474180 TOTAL: 758.65 474181 07/22/2022 PRTD 142773 MIDWEST GROUNDCOVER 22063 06/23/2022 20220722 6,776.00 MIDWEST GROUNDCOVER 22064 06/23/2022 20220722 5,544.00 CHECK 474181 TOTAL: 12,320.00 474182 07/22/2022 PRTD 145395 MILK AND HONEY LLC 10563 06/30/2022 20220722 294.00 CHECK 474182 TOTAL: 294.00 474183 07/22/2022 PRTD 144836 MINNEAPOLIS COMMERCIAL MOWER INC 356022 06/27/2022 20220722 789.98 CHECK 474183 TOTAL: 789.98 474184 07/22/2022 PRTD 100522 MINNESOTA AIR INC 1858331-00 06/22/2022 20220722 216.46 CHECK 474184 TOTAL: 216.46 474185 07/22/2022 PRTD 145641 MINNESOTA MANDOLIN ORCHESTRA 22CLP0046 07/20/2022 20220722 150.00 CHECK 474185 TOTAL: 150.00 474186 07/22/2022 PRTD 100252 MINNESOTA STATE COLLEGES AND UNIV 1044504 06/27/2022 20220722 1,000.00 CHECK 474186 TOTAL: 1,000.00 474187 07/22/2022 PRTD 128914 BJKK DEVELOPMENT 32792 04/14/2022 20220722 105.00 BJKK DEVELOPMENT 33133 06/21/2022 20220722 42.00 BJKK DEVELOPMENT 33138 06/22/2022 20220722 35.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 18 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET BJKK DEVELOPMENT 33137 06/22/2022 20220722 37.00 BJKK DEVELOPMENT 33136 06/22/2022 20220722 32.00 CHECK 474187 TOTAL: 251.00 474188 07/22/2022 PRTD 160457 MISS MYRA AND THE MOONSHINERS LLC 22CLP0062 07/20/2022 20220722 150.00 CHECK 474188 TOTAL: 150.00 474189 07/22/2022 PRTD 140955 MODIST BREWING LLC E-32477 06/28/2022 20220722 269.00 MODIST BREWING LLC E-32481 06/28/2022 20220722 475.00 CHECK 474189 TOTAL: 744.00 474190 07/22/2022 PRTD 108668 MORRIS, GRAYLYN 22CLP0056 07/20/2022 20220722 250.00 CHECK 474190 TOTAL: 250.00 474191 07/22/2022 PRTD 100906 MTI DISTRIBUTING INC 1344491-01 06/22/2022 20220722 190.45 MTI DISTRIBUTING INC 1351341-00 06/24/2022 20220722 741.85 MTI DISTRIBUTING INC 1348414-00 06/27/2022 20220722 231.98 CHECK 474191 TOTAL: 1,164.28 474192 07/22/2022 PRTD 100920 GENUINE PARTS COMPANY 3599-172570 06/26/2022 20220722 141.80 GENUINE PARTS COMPANY 3599-172049 06/22/2022 20220722 161.49 GENUINE PARTS COMPANY 2122-839492 06/03/2022 20220722 158.08 GENUINE PARTS COMPANY 2122-840000 06/06/2022 20220722 -158.08 GENUINE PARTS COMPANY 2122-839999 06/06/2022 20220722 158.08 CHECK 474192 TOTAL: 461.37 474193 07/22/2022 PRTD 160385 ODP BUSINESS SOLUTIONS LLC 252043665001 06/27/2022 20220722 54.50 CHECK 474193 TOTAL: 54.50 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 19 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474194 07/22/2022 PRTD 141965 OMNI BREWING COMPANY LLC E-12224 06/30/2022 20220722 90.00 CHECK 474194 TOTAL: 90.00 474195 07/22/2022 PRTD 141990 OMODT, PAUL G 2022-5 06/22/2022 20220722 1,600.00 CHECK 474195 TOTAL: 1,600.00 474196 07/22/2022 PRTD 999998 Chiyoko Hachiya 1452571392-REFUND 12/22/2021 20220722 1,644.20 CHECK 474196 TOTAL: 1,644.20 474197 07/22/2022 PRTD 999998 Gray, Charles 273-22-0074 07/05/2022 20220722 1,582.61 CHECK 474197 TOTAL: 1,582.61 474198 07/22/2022 PRTD 999998 Truesdale, Clark W 273-22-0584 07/05/2022 20220722 1,798.20 CHECK 474198 TOTAL: 1,798.20 474199 07/22/2022 PRTD 999994 RAYCO CONSTRUCTION INC ED190008-REFUND 07/14/2022 20220722 240.00 CHECK 474199 TOTAL: 240.00 474200 07/22/2022 PRTD 999994 Sabre Plumbing Heating & AC ED196236-REFUND 07/13/2022 20220722 980.53 CHECK 474200 TOTAL: 980.53 474201 07/22/2022 PRTD 999994 Sabre Plumbing Heating & AC ED196237-REFUND 07/13/2022 20220722 714.34 CHECK 474201 TOTAL: 714.34 474202 07/22/2022 PRTD 999996 Auleceims, Skai 42404071-REFUND 07/12/2022 20220722 10.00 CHECK 474202 TOTAL: 10.00 474203 07/22/2022 PRTD 999996 Edstrom, Jeanine 42329971-REFUND 07/11/2022 20220722 54.00 CHECK 474203 TOTAL: 54.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 20 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474204 07/22/2022 PRTD 999996 Griffiths, Anne 42439588-REFUND 07/12/2022 20220722 360.00 CHECK 474204 TOTAL: 360.00 474205 07/22/2022 PRTD 999996 Hensley, Kate 42343281-REFUND 07/11/2022 20220722 144.00 CHECK 474205 TOTAL: 144.00 474206 07/22/2022 PRTD 999996 Jellen, Rosemary 42329555-REFUND 07/11/2022 20220722 175.00 CHECK 474206 TOTAL: 175.00 474207 07/22/2022 PRTD 999996 Kaiser, Tana 42477392-REFUND 07/13/2022 20220722 224.00 CHECK 474207 TOTAL: 224.00 474208 07/22/2022 PRTD 999996 Kretzman, Kim 42498975-REFUND 07/13/2022 20220722 64.00 CHECK 474208 TOTAL: 64.00 474209 07/22/2022 PRTD 999996 Kretzman, Kim 42498977-REFUND 07/13/2022 20220722 64.00 CHECK 474209 TOTAL: 64.00 474210 07/22/2022 PRTD 999996 Liu, Karen 42440267-REFUND 07/12/2022 20220722 90.00 CHECK 474210 TOTAL: 90.00 474211 07/22/2022 PRTD 999996 Ohalloran, Gerard 42551099-REFUND 07/14/2022 20220722 35.00 CHECK 474211 TOTAL: 35.00 474212 07/22/2022 PRTD 999996 Olson, Laura 42479778-REFUND 07/13/2022 20220722 368.00 CHECK 474212 TOTAL: 368.00 474213 07/22/2022 PRTD 999996 Sandler, Michelle 42410713-REFUND 07/12/2022 20220722 63.00 CHECK 474213 TOTAL: 63.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 21 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474214 07/22/2022 PRTD 999996 Scherer, Jessica 42833115-REFUND 07/18/2022 20220722 90.00 CHECK 474214 TOTAL: 90.00 474215 07/22/2022 PRTD 999996 Stevens, Drew 42009066-REFUND 07/06/2022 20220722 90.00 CHECK 474215 TOTAL: 90.00 474216 07/22/2022 PRTD 999996 Thomas, Alyssa 42515182-REFUND 07/13/2022 20220722 125.00 CHECK 474216 TOTAL: 125.00 474217 07/22/2022 PRTD 999996 Widmoyer, Darrah 42005676-REFUND 07/06/2022 20220722 70.00 CHECK 474217 TOTAL: 70.00 474218 07/22/2022 PRTD 999997 ANDERSON,CHAD 00117470-7/6/2022 07/06/2022 20220722 109.09 CHECK 474218 TOTAL: 109.09 474219 07/22/2022 PRTD 999997 ANDRICK,MATTHEW 00127581-7/6/2022 07/06/2022 20220722 101.45 CHECK 474219 TOTAL: 101.45 474220 07/22/2022 PRTD 999997 BANDT,SHERRYL 00121821-7/6/2022 07/06/2022 20220722 26.98 CHECK 474220 TOTAL: 26.98 474221 07/22/2022 PRTD 999997 BECKMANN,HEINO 00090350-7/6/2022 07/06/2022 20220722 110.16 CHECK 474221 TOTAL: 110.16 474222 07/22/2022 PRTD 999997 BERMAN,FRANK 00121926-7/6/2022 07/06/2022 20220722 642.38 CHECK 474222 TOTAL: 642.38 474223 07/22/2022 PRTD 999997 BLOOM,SCOTT 00088610-7/6/2022 07/06/2022 20220722 25.03 CHECK 474223 TOTAL: 25.03 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 22 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474224 07/22/2022 PRTD 999997 BOE,JORDAN 00126471-7/6/2022 07/06/2022 20220722 2.68 CHECK 474224 TOTAL: 2.68 474225 07/22/2022 PRTD 999997 BRENNER,TIMOTHY 00112510-7/6/2022 07/06/2022 20220722 34.51 CHECK 474225 TOTAL: 34.51 474226 07/22/2022 PRTD 999997 BRINGGOLD,GARY 00079623-7/6/2022 07/06/2022 20220722 691.90 CHECK 474226 TOTAL: 691.90 474227 07/22/2022 PRTD 999997 BUETTNER,SARAH 00125287-7/6/2022 07/06/2022 20220722 200.00 CHECK 474227 TOTAL: 200.00 474228 07/22/2022 PRTD 999997 BUNDAY,BEVERLY 00086832-7/6/2022 07/06/2022 20220722 14.85 CHECK 474228 TOTAL: 14.85 474229 07/22/2022 PRTD 999997 BURKE,JULIE 00126290-7/6/2022 07/06/2022 20220722 28.97 CHECK 474229 TOTAL: 28.97 474230 07/22/2022 PRTD 999997 BURLEYS HAIR SALON 00124976-7/6/2022 07/06/2022 20220722 2.28 CHECK 474230 TOTAL: 2.28 474231 07/22/2022 PRTD 999997 BURROWS,JEFF 00109902-7/6/2022 07/06/2022 20220722 175.00 CHECK 474231 TOTAL: 175.00 474232 07/22/2022 PRTD 999997 BYNUM,TREVOR 00120067-7/6/2022 07/06/2022 20220722 150.54 CHECK 474232 TOTAL: 150.54 474233 07/22/2022 PRTD 999997 CARMICHIEL,CAROL 00077576-7/6/2022 07/06/2022 20220722 23.13 CHECK 474233 TOTAL: 23.13 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 23 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474234 07/22/2022 PRTD 999997 CARPENTER,BENJAMIN 00105261-7/6/2022 07/06/2022 20220722 305.64 CHECK 474234 TOTAL: 305.64 474235 07/22/2022 PRTD 999997 CCREFIV-CCRP METRO BOULEVARD EDIN 00126401-7/13/2022 07/13/2022 20220722 8,280.06 CHECK 474235 TOTAL: 8,280.06 474236 07/22/2022 PRTD 999997 CCREFIV-CCRP METRO BOULEVARD EDIN 00126161-7/13/2022 07/13/2022 20220722 11,806.24 CHECK 474236 TOTAL: 11,806.24 474237 07/22/2022 PRTD 999997 CERF,LAWRENCE 00112116-7/6/2022 07/06/2022 20220722 45.48 CHECK 474237 TOTAL: 45.48 474238 07/22/2022 PRTD 999997 CHAFFEE,JONATHON 00117476-7/6/2022 07/06/2022 20220722 268.58 CHECK 474238 TOTAL: 268.58 474239 07/22/2022 PRTD 999997 COLBY,WILLIAM 00079764-7/6/2022 07/06/2022 20220722 201.00 CHECK 474239 TOTAL: 201.00 474240 07/22/2022 PRTD 999997 COLVIN,DOROTHY 00076032-7/6/2022 07/06/2022 20220722 33.54 CHECK 474240 TOTAL: 33.54 474241 07/22/2022 PRTD 999997 CRAFT HOMES LLC 00127913-7/6/2022 07/06/2022 20220722 51.88 CHECK 474241 TOTAL: 51.88 474242 07/22/2022 PRTD 999997 CRAWFORD,PETER 00124546-7/6/2022 07/06/2022 20220722 362.61 CHECK 474242 TOTAL: 362.61 474243 07/22/2022 PRTD 999997 DAVIS,KRISTIN 00122891-7/6/2022 07/06/2022 20220722 190.72 CHECK 474243 TOTAL: 190.72 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 24 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474244 07/22/2022 PRTD 999997 DEJOLSVAY,DIANE 00105203-7/6/2022 07/06/2022 20220722 57.93 CHECK 474244 TOTAL: 57.93 474245 07/22/2022 PRTD 999997 DEMING,MONICA 00122066-7/6/2022 07/06/2022 20220722 105.25 CHECK 474245 TOTAL: 105.25 474246 07/22/2022 PRTD 999997 DOVOLIS,DEAN 00085323-7/6/2022 07/06/2022 20220722 9.44 CHECK 474246 TOTAL: 9.44 474247 07/22/2022 PRTD 999997 ERLING,STEVE 00105750-7/6/2022 07/06/2022 20220722 93.86 CHECK 474247 TOTAL: 93.86 474248 07/22/2022 PRTD 999997 FANTIN,CONSTANCE 00108777-7/6/2022 07/06/2022 20220722 159.11 CHECK 474248 TOTAL: 159.11 474249 07/22/2022 PRTD 999997 FRISWOLD,FRED 00110237-7/6/2022 07/06/2022 20220722 202.00 CHECK 474249 TOTAL: 202.00 474250 07/22/2022 PRTD 999997 GALLIVAN,KAREN 00092253-7/6/2022 07/06/2022 20220722 329.07 CHECK 474250 TOTAL: 329.07 474251 07/22/2022 PRTD 999997 GAO,LING 00118006-7/6/2022 07/06/2022 20220722 315.80 CHECK 474251 TOTAL: 315.80 474252 07/22/2022 PRTD 999997 GARBERG,JAMES 00106785-7/6/2022 07/06/2022 20220722 216.86 CHECK 474252 TOTAL: 216.86 474253 07/22/2022 PRTD 999997 GE,WEI 00120531-7/6/2022 07/06/2022 20220722 14.63 CHECK 474253 TOTAL: 14.63 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 25 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474254 07/22/2022 PRTD 999997 GIESEKE,DANIEL 00091448-7/6/2022 07/06/2022 20220722 22.32 CHECK 474254 TOTAL: 22.32 474255 07/22/2022 PRTD 999997 GILBERTSON,LEE 00106012-7/6/2022 07/06/2022 20220722 26.48 CHECK 474255 TOTAL: 26.48 474256 07/22/2022 PRTD 999997 GO HUSKY LLC 00128438-7/6/2022 07/06/2022 20220722 42.12 CHECK 474256 TOTAL: 42.12 474257 07/22/2022 PRTD 999997 GRAFF,DALTON 00123934-7/6/2022 07/06/2022 20220722 23.90 CHECK 474257 TOTAL: 23.90 474258 07/22/2022 PRTD 999997 GRAVELLE,KENT 00109537-7/6/2022 07/06/2022 20220722 44.03 CHECK 474258 TOTAL: 44.03 474259 07/22/2022 PRTD 999997 GREVIOUS,LANCE 00085924-7/6/2022 07/06/2022 20220722 44.69 CHECK 474259 TOTAL: 44.69 474260 07/22/2022 PRTD 999997 GRINAGER,PETER 00121924-7/6/2022 07/06/2022 20220722 6.27 CHECK 474260 TOTAL: 6.27 474261 07/22/2022 PRTD 999997 HANKEN,ROBERT 00090067-7/6/2022 07/06/2022 20220722 27.32 CHECK 474261 TOTAL: 27.32 474262 07/22/2022 PRTD 999997 HARRELL,ABBY 00100751-7/6/2022 07/06/2022 20220722 225.00 CHECK 474262 TOTAL: 225.00 474263 07/22/2022 PRTD 999997 HINTZ,MAXIMILLIAN 00119377-7/6/2022 07/06/2022 20220722 76.61 CHECK 474263 TOTAL: 76.61 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 26 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474264 07/22/2022 PRTD 999997 HOLLWAY,ROBERT 00126184-7/6/2022 07/06/2022 20220722 373.33 CHECK 474264 TOTAL: 373.33 474265 07/22/2022 PRTD 999997 HOLMAN,ERIC 00118069-7/6/2022 07/06/2022 20220722 51.13 CHECK 474265 TOTAL: 51.13 474266 07/22/2022 PRTD 999997 HPA US1 LLC 00125532-7/6/2022 07/06/2022 20220722 202.81 CHECK 474266 TOTAL: 202.81 474267 07/22/2022 PRTD 999997 JANA,RUPA 00105583-7/6/2022 07/06/2022 20220722 235.00 CHECK 474267 TOTAL: 235.00 474268 07/22/2022 PRTD 999997 JANOVSKY,LADDY 00122796-7/6/2022 07/06/2022 20220722 65.20 CHECK 474268 TOTAL: 65.20 474269 07/22/2022 PRTD 999997 JOHNSON,ANDREW 00119855-7/6/2022 07/06/2022 20220722 91.25 CHECK 474269 TOTAL: 91.25 474270 07/22/2022 PRTD 999997 JOHNSON,CYNTHIA 00109124-7/6/2022 07/06/2022 20220722 207.82 CHECK 474270 TOTAL: 207.82 474271 07/22/2022 PRTD 999997 KALOGERSON,CALLIE 00110661-7/6/2022 07/06/2022 20220722 189.90 CHECK 474271 TOTAL: 189.90 474272 07/22/2022 PRTD 999997 KENVILLE,SARAH 00126509-7/6/2022 07/06/2022 20220722 320.00 CHECK 474272 TOTAL: 320.00 474273 07/22/2022 PRTD 999997 KIDZY,DENNIS 00098899-7/6/2022 07/06/2022 20220722 275.00 CHECK 474273 TOTAL: 275.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 27 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474274 07/22/2022 PRTD 999997 KIM,SUNNY 00115367-7/6/2022 07/06/2022 20220722 133.47 CHECK 474274 TOTAL: 133.47 474275 07/22/2022 PRTD 999997 KIRAKAWA,CHIZUKO 00078368-7/6/2022 07/06/2022 20220722 213.84 CHECK 474275 TOTAL: 213.84 474276 07/22/2022 PRTD 999997 KOEPPL,TIM 00119894-7/6/2022 07/06/2022 20220722 195.27 CHECK 474276 TOTAL: 195.27 474277 07/22/2022 PRTD 999997 LACSAMANA,ARIEL 00102692-7/6/2022 07/06/2022 20220722 11.43 CHECK 474277 TOTAL: 11.43 474278 07/22/2022 PRTD 999997 LASKIN,ROISIN 00123268-7/6/2022 07/06/2022 20220722 50.99 CHECK 474278 TOTAL: 50.99 474279 07/22/2022 PRTD 999997 LAWTON,BRIAN 00127826-7/6/2022 07/06/2022 20220722 25.27 CHECK 474279 TOTAL: 25.27 474280 07/22/2022 PRTD 999997 LEAF,COLLEEN 00123462-7/6/2022 07/06/2022 20220722 277.86 CHECK 474280 TOTAL: 277.86 474281 07/22/2022 PRTD 999997 LIJESEN,ARNOUT 00122343-7/6/2022 07/06/2022 20220722 12.10 CHECK 474281 TOTAL: 12.10 474282 07/22/2022 PRTD 999997 LOHANI,UDAY 00104513-7/6/2022 07/06/2022 20220722 300.10 CHECK 474282 TOTAL: 300.10 474283 07/22/2022 PRTD 999997 LUND,ROAR 00078448-7/6/2022 07/06/2022 20220722 30.84 CHECK 474283 TOTAL: 30.84 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 28 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474284 07/22/2022 PRTD 999997 MAINVILLE,CANDACE 00086709-7/6/2022 07/06/2022 20220722 275.00 CHECK 474284 TOTAL: 275.00 474285 07/22/2022 PRTD 999997 MASON,REID 00123369-7/6/2022 07/06/2022 20220722 268.81 CHECK 474285 TOTAL: 268.81 474286 07/22/2022 PRTD 999997 MASTERMAN,MICHAEL 00078189-7/6/2022 07/06/2022 20220722 250.00 CHECK 474286 TOTAL: 250.00 474287 07/22/2022 PRTD 999997 MCMERTY,JAMES 00122266-7/6/2022 07/06/2022 20220722 250.00 CHECK 474287 TOTAL: 250.00 474288 07/22/2022 PRTD 999997 MENDEZ,MELISSA 00109215-7/6/2022 07/06/2022 20220722 15.54 CHECK 474288 TOTAL: 15.54 474289 07/22/2022 PRTD 999997 MILLER,ROBERT 00119439-7/6/2022 07/06/2022 20220722 241.73 CHECK 474289 TOTAL: 241.73 474290 07/22/2022 PRTD 999997 MINN,STEVE 00097486-7/6/2022 07/06/2022 20220722 200.00 CHECK 474290 TOTAL: 200.00 474291 07/22/2022 PRTD 999997 MITCHELL,JOHN 00084493-7/6/2022 07/06/2022 20220722 35.71 CHECK 474291 TOTAL: 35.71 474292 07/22/2022 PRTD 999997 MOBARRY,JOY 00089536-7/6/2022 07/06/2022 20220722 94.40 CHECK 474292 TOTAL: 94.40 474293 07/22/2022 PRTD 999997 MOE,PATRICIA 00088526-7/6/2022 07/06/2022 20220722 16.64 CHECK 474293 TOTAL: 16.64 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 29 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474294 07/22/2022 PRTD 999997 MOHTADI,HAMID DR 00121568-7/6/2022 07/06/2022 20220722 40.76 CHECK 474294 TOTAL: 40.76 474295 07/22/2022 PRTD 999997 MOLLISON,KATHERINE 00110755-7/6/2022 07/06/2022 20220722 5.78 CHECK 474295 TOTAL: 5.78 474296 07/22/2022 PRTD 999997 MOQUIST,ALLISON 00122801-7/6/2022 07/06/2022 20220722 31.97 CHECK 474296 TOTAL: 31.97 474297 07/22/2022 PRTD 999997 MORROW,JOHN 00122862-7/6/2022 07/06/2022 20220722 41.77 CHECK 474297 TOTAL: 41.77 474298 07/22/2022 PRTD 999997 MULHERAN,PETER 00118676-7/6/2022 07/06/2022 20220722 238.00 CHECK 474298 TOTAL: 238.00 474299 07/22/2022 PRTD 999997 MURPHY,KATE 00122782-7/6/2022 07/06/2022 20220722 52.12 CHECK 474299 TOTAL: 52.12 474300 07/22/2022 PRTD 999997 O'BRIEN,CHRISTOPHER 00114402-7/6/2022 07/06/2022 20220722 375.00 CHECK 474300 TOTAL: 375.00 474301 07/22/2022 PRTD 999997 OLSON,KEITH 00122450-7/6/2022 07/06/2022 20220722 176.91 CHECK 474301 TOTAL: 176.91 474302 07/22/2022 PRTD 999997 OLSON,LES 00104716-7/6/2022 07/06/2022 20220722 9.14 CHECK 474302 TOTAL: 9.14 474303 07/22/2022 PRTD 999997 OSBORNE,MARC 00117962-7/6/2022 07/06/2022 20220722 178.53 CHECK 474303 TOTAL: 178.53 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 30 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474304 07/22/2022 PRTD 999997 PALUSKY,GENE 00123894-7/6/2022 07/06/2022 20220722 229.62 CHECK 474304 TOTAL: 229.62 474305 07/22/2022 PRTD 999997 PARRY,JANE 00077851-7/6/2022 07/06/2022 20220722 28.71 CHECK 474305 TOTAL: 28.71 474306 07/22/2022 PRTD 999997 PAWLICKI,JUSTIN 00116602-7/6/2022 07/06/2022 20220722 61.83 CHECK 474306 TOTAL: 61.83 474307 07/22/2022 PRTD 999997 RAMINEZ,GLORIA 00124133-7/6/2022 07/06/2022 20220722 49.54 CHECK 474307 TOTAL: 49.54 474308 07/22/2022 PRTD 999997 RASMUSSEN,BEN 00122900-7/6/2022 07/06/2022 20220722 709.09 CHECK 474308 TOTAL: 709.09 474309 07/22/2022 PRTD 999997 RIGGEN,BRIAN 00124607-7/6/2022 07/06/2022 20220722 44.69 CHECK 474309 TOTAL: 44.69 474310 07/22/2022 PRTD 999997 RINGHAND,KERRY 00124866-4/26/22 04/26/2022 20220722 199.78 CHECK 474310 TOTAL: 199.78 474311 07/22/2022 PRTD 999997 RIVARD,JILL 00085671-7/6/2022 07/06/2022 20220722 248.01 CHECK 474311 TOTAL: 248.01 474312 07/22/2022 PRTD 999997 ROSE,DOUGLAS 00106936-7/6/2022 07/06/2022 20220722 218.22 CHECK 474312 TOTAL: 218.22 474313 07/22/2022 PRTD 999997 ROSSMAN,JAMES 00101335-7/6/2022 07/06/2022 20220722 27.31 CHECK 474313 TOTAL: 27.31 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 31 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474314 07/22/2022 PRTD 999997 RUZIN,CHRISTINE 00104663-7/6/2022 07/06/2022 20220722 300.00 CHECK 474314 TOTAL: 300.00 474315 07/22/2022 PRTD 999997 RYAN,JOHN 00079231-7/6/2022 07/06/2022 20220722 275.00 CHECK 474315 TOTAL: 275.00 474316 07/22/2022 PRTD 999997 SADUSKY,JOHN 00128534-7/6/2022 07/06/2022 20220722 95.32 CHECK 474316 TOTAL: 95.32 474317 07/22/2022 PRTD 999997 SCHAIDLER,JENNIFER 00116509-7/6/2022 07/06/2022 20220722 214.00 CHECK 474317 TOTAL: 214.00 474318 07/22/2022 PRTD 999997 SCHAUERMAN,THOMAS 00107532-7/6/2022 07/06/2022 20220722 25.42 CHECK 474318 TOTAL: 25.42 474319 07/22/2022 PRTD 999997 SCHELL,JIM 00082100-7/6/2022 07/06/2022 20220722 113.96 CHECK 474319 TOTAL: 113.96 474320 07/22/2022 PRTD 999997 SCHMITT,C 00076752-7/6/2022 07/06/2022 20220722 25.15 CHECK 474320 TOTAL: 25.15 474321 07/22/2022 PRTD 999997 SCHROEDER,JOAN 00079246-7/6/2022 07/06/2022 20220722 69.10 CHECK 474321 TOTAL: 69.10 474322 07/22/2022 PRTD 999997 SETHI,ANKIT 00122185-7/6/2022 07/06/2022 20220722 12.25 CHECK 474322 TOTAL: 12.25 474323 07/22/2022 PRTD 999997 SHENAI,VASANTH 00122405-7/6/2022 07/06/2022 20220722 76.71 CHECK 474323 TOTAL: 76.71 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 32 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474324 07/22/2022 PRTD 999997 SIDDIQUI,MUSTAQEEM 00126503-7/6/2022 07/06/2022 20220722 167.18 CHECK 474324 TOTAL: 167.18 474325 07/22/2022 PRTD 999997 SINN,ZAK 00118035-7/6/2022 07/06/2022 20220722 24.19 CHECK 474325 TOTAL: 24.19 474326 07/22/2022 PRTD 999997 SKINNER,JOHN 00080815-7/6/2022 07/06/2022 20220722 156.41 CHECK 474326 TOTAL: 156.41 474327 07/22/2022 PRTD 999997 SNYDER,KELLY 00127015-7/6/2022 07/06/2022 20220722 19.83 CHECK 474327 TOTAL: 19.83 474328 07/22/2022 PRTD 999997 SODERLING,PETER 00124581-7/6/2022 07/06/2022 20220722 107.71 CHECK 474328 TOTAL: 107.71 474329 07/22/2022 PRTD 999997 SOLTAU,JAMES 00082611-7/6/2022 07/06/2022 20220722 49.90 CHECK 474329 TOTAL: 49.90 474330 07/22/2022 PRTD 999997 STENSBY,GARY 00085329-7/6/2022 07/06/2022 20220722 187.85 CHECK 474330 TOTAL: 187.85 474331 07/22/2022 PRTD 999997 STUKAS,NICK 00122443-7/6/2022 07/06/2022 20220722 57.57 CHECK 474331 TOTAL: 57.57 474332 07/22/2022 PRTD 999997 SWENDSEN,ANNE 00118999-7/6/2022 07/06/2022 20220722 277.29 CHECK 474332 TOTAL: 277.29 474333 07/22/2022 PRTD 999997 THINGELSTAD,TAMMY 00125162-7/6/2022 07/06/2022 20220722 10.81 CHECK 474333 TOTAL: 10.81 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 33 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474334 07/22/2022 PRTD 999997 VALDIVIA,TOM 00127340-7/6/2022 07/06/2022 20220722 285.93 CHECK 474334 TOTAL: 285.93 474335 07/22/2022 PRTD 999997 WALKLEY,CAROLINE 00122731-7/6/2022 07/06/2022 20220722 155.13 CHECK 474335 TOTAL: 155.13 474336 07/22/2022 PRTD 999997 WANNER,THOMAS 00089873-7/6/2022 07/06/2022 20220722 36.83 CHECK 474336 TOTAL: 36.83 474337 07/22/2022 PRTD 999997 WEBER,TOM 00089551-7/6/2022 07/06/2022 20220722 26.99 CHECK 474337 TOTAL: 26.99 474338 07/22/2022 PRTD 999997 WILLIAMS,EVAN 00127218-7/6/2022 07/06/2022 20220722 64.82 CHECK 474338 TOTAL: 64.82 474339 07/22/2022 PRTD 999997 WILLIAMSON,STANLEY 00118268-7/6/2022 07/06/2022 20220722 138.71 CHECK 474339 TOTAL: 138.71 474340 07/22/2022 PRTD 999997 WONG,KIN 00125103-7/6/2022 07/06/2022 20220722 13.88 CHECK 474340 TOTAL: 13.88 474341 07/22/2022 PRTD 999997 ZIEGLER,TARA 00126065-7/6/2022 07/06/2022 20220722 104.16 CHECK 474341 TOTAL: 104.16 474342 07/22/2022 PRTD 129214 OUVERSON SEWER AND WATER INC 6857 06/10/2022 20220722 10,070.00 CHECK 474342 TOTAL: 10,070.00 474343 07/22/2022 PRTD 146766 CHOPS, INC 22CLP0059 07/20/2022 20220722 150.00 CHECK 474343 TOTAL: 150.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 34 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474344 07/22/2022 PRTD 129485 PAPCO INC 225430 06/24/2022 20220722 435.04 CHECK 474344 TOTAL: 435.04 474345 07/22/2022 PRTD 100945 PEPSI-COLA COMPANY 60793911 07/01/2022 20220722 655.08 PEPSI-COLA COMPANY 29164651 07/07/2022 20220722 244.02 CHECK 474345 TOTAL: 899.10 474346 07/22/2022 PRTD 149249 PEQUOD DISTRIBUTING W-152976 06/30/2022 20220722 562.30 PEQUOD DISTRIBUTING W-152959 06/30/2022 20220722 83.00 PEQUOD DISTRIBUTING W-152108 06/30/2022 20220722 83.00 CHECK 474346 TOTAL: 728.30 474347 07/22/2022 PRTD 100119 PING INC 16360871 06/03/2022 20220722 421.05 PING INC 16367762 06/07/2022 20220722 233.81 PING INC 16370837 06/08/2022 20220722 148.65 CHECK 474347 TOTAL: 803.51 474348 07/22/2022 PRTD 119620 POMP'S TIRE SERVICE INC 210599557 06/21/2022 20220722 739.15 CHECK 474348 TOTAL: 739.15 474349 07/22/2022 PRTD 125979 PRECISE MRM LLC 200-1037492 06/27/2022 20220722 1,050.00 PRECISE MRM LLC 200-1037487 06/27/2022 20220722 125.00 CHECK 474349 TOTAL: 1,175.00 474350 07/22/2022 PRTD 129706 PREMIUM WATERS INC 318872922 07/06/2022 20220722 23.99 PREMIUM WATERS INC 318888177 07/15/2022 20220722 41.99 CHECK 474350 TOTAL: 65.98 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 35 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474351 07/22/2022 PRTD 160246 QUADIENT FINANCE USA INC 11294185-7/10/22 07/10/2022 20220722 500.00 CHECK 474351 TOTAL: 500.00 474352 07/22/2022 PRTD 131685 QUADIENT LEASING US, INC. N9465580 06/23/2022 20220722 454.05 CHECK 474352 TOTAL: 454.05 474353 07/22/2022 PRTD 160037 RACHEL CONTRACTING, LLC ENG 21032 #1 06/20/2022 20220722 153,443.72 CHECK 474353 TOTAL: 153,443.72 474354 07/22/2022 PRTD 133091 RANGE SERVANT AMERICA INC 116727 06/21/2022 20220722 895.26 CHECK 474354 TOTAL: 895.26 474355 07/22/2022 PRTD 104643 RECREATION SUPPLY COMPANY INC 469330 06/25/2022 20220722 5,842.69 CHECK 474355 TOTAL: 5,842.69 474356 07/22/2022 PRTD 125936 REINDERS INC 3088752-00 06/23/2022 20220722 440.00 CHECK 474356 TOTAL: 440.00 474357 07/22/2022 PRTD 133627 REPUBLIC SERVICES #894 0894-005815801 06/30/2022 20220722 46,210.39 CHECK 474357 TOTAL: 46,210.39 474358 07/22/2022 PRTD 102420 RETROFIT COMPANIES INC 0116489-IN 06/21/2022 20220722 2,355.00 CHECK 474358 TOTAL: 2,355.00 474359 07/22/2022 PRTD 132051 RICHARD ALAN PRODUCTIONS 22CLP0049 07/20/2022 20220722 300.00 CHECK 474359 TOTAL: 300.00 474360 07/22/2022 PRTD 100977 RICHFIELD PLUMBING COMPANY 84933 06/21/2022 20220722 552.00 CHECK 474360 TOTAL: 552.00 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 36 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474361 07/22/2022 PRTD 101659 ORKIN 227419391 06/21/2022 20220722 32.10 ORKIN 227418864 06/21/2022 20220722 26.28 ORKIN 227419445 06/21/2022 20220722 30.00 CHECK 474361 TOTAL: 88.38 474362 07/22/2022 PRTD 160458 RUDDY, PETER 22CLP0070 07/20/2022 20220722 150.00 CHECK 474362 TOTAL: 150.00 474363 07/22/2022 PRTD 100988 SAFETY KLEEN SYSTEMS INC 89151936 06/24/2022 20220722 296.52 SAFETY KLEEN SYSTEMS INC R002847978 06/27/2022 20220722 124.21 CHECK 474363 TOTAL: 420.73 474364 07/22/2022 PRTD 101431 SCAN AIR FILTER INC 155787 06/22/2022 20220722 104.78 CHECK 474364 TOTAL: 104.78 474365 07/22/2022 PRTD 141332 SOUTH TOWN REFRIGERATION INC W76868 06/24/2022 20220722 1,001.08 CHECK 474365 TOTAL: 1,001.08 474366 07/22/2022 PRTD 104689 SERIGRAPHICS SIGN SYSTEMS INC 64207 07/08/2022 20220722 265.50 CHECK 474366 TOTAL: 265.50 474367 07/22/2022 PRTD 100998 SHERWIN WILLIAMS CO 9885-5 06/27/2022 20220722 22.76 CHECK 474367 TOTAL: 22.76 474368 07/22/2022 PRTD 120784 WALSH GRAPHICS INC 17312 06/22/2022 20220722 553.33 WALSH GRAPHICS INC 17321 06/22/2022 20220722 630.00 CHECK 474368 TOTAL: 1,183.33 474369 07/22/2022 PRTD 137482 SITEONE LANDSCAPE SUPPLY LLC 120591093-001 06/21/2022 20220722 73.32 SITEONE LANDSCAPE SUPPLY LLC 120572913-001 06/21/2022 20220722 613.14 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 37 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET SITEONE LANDSCAPE SUPPLY LLC 120705203-001 06/23/2022 20220722 68.08 SITEONE LANDSCAPE SUPPLY LLC 120738163-001 06/24/2022 20220722 431.51 CHECK 474369 TOTAL: 1,186.05 474370 07/22/2022 PRTD 132195 SMALL LOT MN MN54287 07/05/2022 20220722 164.96 SMALL LOT MN MN54288 07/05/2022 20220722 112.68 SMALL LOT MN MN54286 07/05/2022 20220722 121.04 CHECK 474370 TOTAL: 398.68 474371 07/22/2022 PRTD 100430 SNAP-ON INDUSTRIAL ARV/53399349 06/22/2022 20220722 91.02 CHECK 474371 TOTAL: 91.02 474372 07/22/2022 PRTD 160349 SNAP-ON TOOLS COMPANY LLC 06022297592 06/22/2022 20220722 4,690.00 CHECK 474372 TOTAL: 4,690.00 474373 07/22/2022 PRTD 101000 RJM PRINTING INC 120685012 05/05/2022 20220722 206.29 CHECK 474373 TOTAL: 206.29 474374 07/22/2022 PRTD 140502 SOUTH METRO FIRE DEPARTMENT SMFD-06/2022-2 06/27/2022 20220722 15.67 CHECK 474374 TOTAL: 15.67 474375 07/22/2022 PRTD 127878 SOUTHERN GLAZERS WINE & SPIRITS L 2230076 06/30/2022 20220722 117.88 SOUTHERN GLAZERS WINE & SPIRITS L 2230077 06/30/2022 20220722 316.41 SOUTHERN GLAZERS WINE & SPIRITS L 2228617 06/30/2022 20220722 1,124.77 SOUTHERN GLAZERS WINE & SPIRITS L 2230078 06/30/2022 20220722 117.88 SOUTHERN GLAZERS WINE & SPIRITS L 2231136 07/06/2022 20220722 3,618.24 CHECK 474375 TOTAL: 5,295.18 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 38 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474376 07/22/2022 PRTD 101023 SOUTHWEST SUBURBAN CABLE COMMISSI 202212 07/05/2022 20220722 15,497.00 CHECK 474376 TOTAL: 15,497.00 474377 07/22/2022 PRTD 101004 SPS COMPANIES INC S4663228.001 07/05/2022 20220722 1.77 CHECK 474377 TOTAL: 1.77 474378 07/22/2022 PRTD 145599 SSI MN TRANCHE 1 LLC 33397 06/15/2022 20220722 43,240.19 CHECK 474378 TOTAL: 43,240.19 474379 07/22/2022 PRTD 102251 ST ANDREWS PRODUCTS CO 19075 06/24/2022 20220722 7,485.36 CHECK 474379 TOTAL: 7,485.36 474380 07/22/2022 PRTD 102371 STANDARD SPRING PARTS 393861 06/23/2022 20220722 407.52 CHECK 474380 TOTAL: 407.52 474381 07/22/2022 PRTD 100438 STANTEC CONSULTING SERVICES INC 1936695 06/23/2022 20220722 2,382.00 CHECK 474381 TOTAL: 2,382.00 474382 07/22/2022 PRTD 105842 MINER, LTD 793369 06/22/2022 20220722 590.00 CHECK 474382 TOTAL: 590.00 474383 07/22/2022 PRTD 160453 STATE INSURANCE FUND 9289547-000 06/29/2022 20220722 282.00 CHECK 474383 TOTAL: 282.00 474384 07/22/2022 PRTD 139006 OFFICE OF MNIT SERVICES W22040552 05/16/2022 20220722 -4,515.47 OFFICE OF MNIT SERVICES W22050545 06/16/2022 20220722 3,231.02 OFFICE OF MNIT SERVICES W22060542 07/19/2022 20220722 1,602.18 CHECK 474384 TOTAL: 317.73 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 39 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474385 07/22/2022 PRTD 139006 DATA PRACTICES OFFICE 00000706544 06/27/2022 20220722 125.00 CHECK 474385 TOTAL: 125.00 474386 07/22/2022 PRTD 160460 STOEBNER, CONOR 22CLP0051 07/20/2022 20220722 150.00 CHECK 474386 TOTAL: 150.00 474387 07/22/2022 PRTD 101015 STREICHERS INC I1575233 06/21/2022 20220722 66.98 CHECK 474387 TOTAL: 66.98 474388 07/22/2022 PRTD 102639 STROHMYER, TOM 22CLP0064 07/20/2022 20220722 150.00 CHECK 474388 TOTAL: 150.00 474389 07/22/2022 PRTD 105874 SUBURBAN TIRE WHOLESALE INC 10187389 06/23/2022 20220722 256.82 CHECK 474389 TOTAL: 256.82 474390 07/22/2022 PRTD 113841 SUMMIT 2202821 06/24/2022 20220722 1,625.00 CHECK 474390 TOTAL: 1,625.00 474391 07/22/2022 PRTD 119864 SYSCO MINNESOTA INC 447094559 06/23/2022 20220722 1,636.77 SYSCO MINNESOTA INC 447100216 06/25/2022 20220722 2,225.28 SYSCO MINNESOTA INC 447101910 06/27/2022 20220722 762.60 SYSCO MINNESOTA INC 447130008 07/14/2022 20220722 -15.99 SYSCO MINNESOTA INC 447139296 07/19/2022 20220722 -2,123.63 CHECK 474391 TOTAL: 2,485.03 474392 07/22/2022 PRTD 137993 TALKPOINT TECHNOLOGIES INC 0016945 06/24/2022 20220722 418.95 CHECK 474392 TOTAL: 418.95 474393 07/22/2022 PRTD 104932 TAYLOR MADE 35988175 06/02/2022 20220722 1,269.39 TAYLOR MADE 36009873 06/09/2022 20220722 634.69 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 40 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474393 TOTAL: 1,904.08 474394 07/22/2022 PRTD 111002 TEE JAY NORTH INC 44314 06/21/2022 20220722 8,111.00 CHECK 474394 TOTAL: 8,111.00 474395 07/22/2022 PRTD 129923 CONTEMPORARY INC V859101 06/22/2022 20220722 47.77 CHECK 474395 TOTAL: 47.77 474396 07/22/2022 PRTD 141353 HARTONG, WILLEM 22CLP0053 07/20/2022 20220722 250.00 CHECK 474396 TOTAL: 250.00 474397 07/22/2022 PRTD 134673 TOTAL MECHANICAL SYSTEMS INC S3574 06/23/2022 20220722 570.00 TOTAL MECHANICAL SYSTEMS INC S3575 06/23/2022 20220722 260.00 TOTAL MECHANICAL SYSTEMS INC S3576 06/23/2022 20220722 320.00 CHECK 474397 TOTAL: 1,150.00 474398 07/22/2022 PRTD 103982 TRAFFIC CONTROL CORPORATION 136756 06/27/2022 20220722 1,005.00 CHECK 474398 TOTAL: 1,005.00 474399 07/22/2022 PRTD 136342 TRAVISMATHEW LLC 90813856 06/24/2022 20220722 460.94 TRAVISMATHEW LLC 90813857 06/24/2022 20220722 370.80 CHECK 474399 TOTAL: 831.74 474400 07/22/2022 PRTD 103218 TRI-STATE BOBCAT R33141 06/21/2022 20220722 2,800.00 CHECK 474400 TOTAL: 2,800.00 474401 07/22/2022 PRTD 101046 TWIN CITY FILTER SERVICE INC 0724428-IN 06/22/2022 20220722 385.68 CHECK 474401 TOTAL: 385.68 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 41 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474402 07/22/2022 PRTD 101360 TWIN CITY HARDWARE COMPANY INC PSI2126575 06/21/2022 20220722 700.00 CHECK 474402 TOTAL: 700.00 474403 07/22/2022 PRTD 146436 TYLER TECHNOLOGIES INC 045-382118 06/01/2022 20220722 23,775.98 TYLER TECHNOLOGIES INC 045-383808 06/22/2022 20220722 3,780.00 CHECK 474403 TOTAL: 27,555.98 474404 07/22/2022 PRTD 103973 ULINE INC 148659889 05/09/2022 20220722 74.37 CHECK 474404 TOTAL: 74.37 474405 07/22/2022 PRTD 142790 UNDERGROUND UTILITY SPECIALTIES I 478 06/24/2022 20220722 5,700.00 UNDERGROUND UTILITY SPECIALTIES I 477 06/24/2022 20220722 5,000.00 CHECK 474405 TOTAL: 10,700.00 474406 07/22/2022 PRTD 131957 UNIVERSAL ATHLETIC, LLC 150-0062216-01 06/27/2022 20220722 680.71 CHECK 474406 TOTAL: 680.71 474407 07/22/2022 PRTD 112118 US BANK 6564843 06/24/2022 20220722 400.00 US BANK 6564654 06/24/2022 20220722 400.00 US BANK 6564557 06/24/2022 20220722 400.00 US BANK 6565045 06/24/2022 20220722 400.00 US BANK 6564558 06/24/2022 20220722 400.00 US BANK 6564718 06/24/2022 20220722 400.00 CHECK 474407 TOTAL: 2,400.00 474408 07/22/2022 PRTD 100050 USPS 79549 07/18/2022 20220722 171.96 CHECK 474408 TOTAL: 171.96 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 42 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474409 07/22/2022 PRTD 103500 VALLEY PAVING INC ENG 21-2 #15 06/16/2022 20220722 237,678.13 CHECK 474409 TOTAL: 237,678.13 474410 07/22/2022 PRTD 101058 VAN PAPER COMPANY 003086 06/22/2022 20220722 496.22 VAN PAPER COMPANY 003207 06/23/2022 20220722 274.92 VAN PAPER COMPANY 003254 06/24/2022 20220722 593.67 VAN PAPER COMPANY 003255 06/24/2022 20220722 130.95 VAN PAPER COMPANY 003230 06/24/2022 20220722 146.98 VAN PAPER COMPANY 003252 06/24/2022 20220722 611.16 VAN PAPER COMPANY 003086-01 06/28/2022 20220722 113.44 VAN PAPER COMPANY 003209 06/23/2022 20220722 1,208.77 CHECK 474410 TOTAL: 3,576.11 474411 07/22/2022 PRTD 160432 VAPEX ENVIRONMENTAL TECHNOLOGIES 00000817 06/21/2022 20220722 6,300.00 CHECK 474411 TOTAL: 6,300.00 474412 07/22/2022 PRTD 144209 VENN BREWING COMPANY LLC 3393 06/30/2022 20220722 169.50 VENN BREWING COMPANY LLC 3394 06/30/2022 20220722 169.50 CHECK 474412 TOTAL: 339.00 474413 07/22/2022 PRTD 101066 VIKING ELECTRIC SUPPLY S005931597.004 06/22/2022 20220722 33.48 VIKING ELECTRIC SUPPLY S005931597.001 06/22/2022 20220722 484.16 VIKING ELECTRIC SUPPLY S005931597.003 06/22/2022 20220722 33.48 VIKING ELECTRIC SUPPLY S005931597.002 06/23/2022 20220722 8.01 VIKING ELECTRIC SUPPLY S005931597.005 06/24/2022 20220722 -33.48 CHECK 474413 TOTAL: 525.65 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 43 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET 474414 07/22/2022 PRTD 119454 VINOCOPIA INC 0307697-IN 06/30/2022 20220722 245.50 VINOCOPIA INC 0307698-IN 06/30/2022 20220722 1,099.25 VINOCOPIA INC 0307699-IN 06/30/2022 20220722 949.00 CHECK 474414 TOTAL: 2,293.75 474415 07/22/2022 PRTD 140285 WALSER BLOOMINGTON TOYOTA 1026975 06/24/2022 20220722 661.60 CHECK 474415 TOTAL: 661.60 474416 07/22/2022 PRTD 132751 WARNING LITES OF MINNESOTA 237335 06/23/2022 20220722 535.20 CHECK 474416 TOTAL: 535.20 474417 07/22/2022 PRTD 101033 WINE COMPANY 208625 07/06/2022 20220722 3,990.00 CHECK 474417 TOTAL: 3,990.00 474418 07/22/2022 PRTD 124503 WINSUPPLY EDEN PRAIRIE MN CO 229380 01 06/23/2022 20220722 14.79 CHECK 474418 TOTAL: 14.79 474419 07/22/2022 PRTD 142162 WOODEN HILL BREWING COMPANY LLC 3531 06/30/2022 20220722 221.40 WOODEN HILL BREWING COMPANY LLC 3530 06/30/2022 20220722 51.00 WOODEN HILL BREWING COMPANY LLC 3533 07/01/2022 20220722 131.40 CHECK 474419 TOTAL: 403.80 474420 07/22/2022 PRTD 160299 WOODEN SHIP BREWING COMPANY 000193 06/23/2022 20220722 90.00 WOODEN SHIP BREWING COMPANY 000192 06/23/2022 20220722 81.00 CHECK 474420 TOTAL: 171.00 474421 07/22/2022 PRTD 105740 WSB & ASSOCIATES R-019788-000-5 06/22/2022 20220722 1,287.00 WSB & ASSOCIATES R-018610-000-11 06/27/2022 20220722 1,828.75 City of Edina, MN A/P CASH DISBURSEMENTS JOURNAL Report generated: 07/21/2022 12:57User: STanGeilProgram ID: apcshdsb Page 44 CASH ACCOUNT: 9999 1012 Control BS - CashAP CHECK NO CHK DATE TYPE VENDOR NAME INVOICE INV DATE PO CHECK RUN NET CHECK 474421 TOTAL: 3,115.75 474422 07/22/2022 PRTD 101572 ZARNOTH BRUSH WORKS INC 0188874-IN 04/05/2022 20220722 396.80 CHECK 474422 TOTAL: 396.80 474423 07/22/2022 PRTD 144890 ZIMMERMAN, CAROL 22CLP0074 07/20/2022 20220722 200.00 ZIMMERMAN, CAROL 22CLP0075 07/20/2022 20220722 200.00 CHECK 474423 TOTAL: 400.00 474424 07/22/2022 PRTD 136192 ZOLL MEDICAL CORPORATION 3524794 06/22/2022 20220722 1,035.00 CHECK 474424 TOTAL: 1,035.00 NUMBER OF CHECKS 355 *** CASH ACCOUNT TOTAL *** 1,465,910.81 COUNT AMOUNT TOTAL PRINTED CHECKS 355 1,465,910.81 *** GRAND TOTAL *** 1,465,910.81 Date: August 3, 2022 Agenda Item #: VI.C. To:Mayor and City Council Item Type: Request For Purchase From:Andrew Scipioni, Transportation Planner Item Activity: Subject:Request for Purchase: 2022 Pavement Rejuvenation Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for pavement rejuvenation services from Corrective Asphalt Materials, LLC for $137,357. INTRODUCTION: This project involves maintenance of 10 miles of recently reconstructed roadways through the application of Reclamite, a maltene-based asphalt rejuvenating agent. The application of this product is an alternative treatment to traditional seal coating or fog sealing applications. ATTACHMENTS: Description Request for Purchase: 2022 Pavement Rejuvenation ENG 22-17NB Contract for 2022 Pavement Rejuvenation Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12200176 Department: Engineering Buyer: Andrew Scipioni Date: 07/22/2022 Requisition Description: 2022 Pavement Rejuvenation Vendor: CORRECTIVE ASPHALT MATERALS, LLC Cost: $137,357.28 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:QUOTE/BD - QUOTE/BID DESCRIPTION: This project involves maintenance of 10 miles of recently reconstructed roadways through the application of Reclamite, a maltene-based asphalt rejuvenating agent. The application of this product is an alternative treatment to traditional seal coating or fog sealing applications. BUDGET IMPACT: This project will be funded by the Public Works Street Department General Fund Budget. The application of this product instead of traditional seal coating will result in additional cost savings as pavement markings (including centerline striping and marked crosswalks) will not have to be protected or replaced after construction. 2 COMMUNITY IMPACT: Pavement rejuvenation will occur between the months of August and September with a completion date of October 1, 2022. Residents along affected streets will receive a letter explaining the process and typical duration of work to be expecting. Impact during construction is generally limited to temporary on-street parking restrictions and lane closures. This project helps protect preceding infrastructure investments on behalf of the City and its residents. Proactive maintenance strategies like this extend the service life of pavements from 20-30 years to 50-60 years. This practice is consistent with Vision Edina's mission statement to "maintain a sound public infrastructure" and results in better roads for longer periods of time throughout the community. ENVIRONMENTAL IMPACT: Compared to seal coating, this produce requires up to 90% less surface aggregate, significantly reducing carbon emissions associated with transporting material to the project locations. This project will not increase or reduce impervious surfaces, but merely treat existing pavements to delay further deterioration and maintenance expenses. The Proactive Pavement Management Program seeks to utilize resources efficiently by performing infrastructure renewal that will provide the greatest lifespan increase for the lowest cost. 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 FORM OF AGREEMENT BETWEEN CITY OF EDINA AND CONTRACTOR FOR NON-BID CONTRACT ENG 22-17NB 2022 PAVEMENT REJUVENATION THIS AGREEMENT made this 3rd day of August, 2022, by and between the CITY OF EDINA, a Minnesota municipal corporation (“Owner” or “City”) and CORRECTIVE ASPHALT MATERIALS, LLC a corporation (“Contractor”). Owner and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents”, all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. City of Edina General Contract Conditions C. Specifications prepared by the City of Edina D. Contractor’s Quote. In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts with Contract Document “A” having the first priority and Contract Document “D” having the last priority. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. CONTRACT PRICE. Owner shall pay Contractor for completion of the Work, in accordance with the Contract $137,357.28 inclusive of taxes, if any. 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by the City Engineer. B. Progress Payments; Retainage. Owner shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractors. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1 ½ percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 (attached) required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Final payment will not be made until the Contractor has filed with the Owner a fully and duly executed Affidavit, General Waiver and Indemnity Agreement, in the form attached hereto as Exhibit B and hereby made a part hereof, together with such other and additional evidence as Owner may request, in form and substance satisfactory to the Owner, that all labor, materials and services expended or used in the Work have been paid for in full and that no liens or other claims for such labor, materials or services can be made or claimed against Contractor, Owner or any other person or any property. In case such evidence is not furnished, the Owner may retain out of any amount due said Contractor a sum sufficient, in the reasonable discretion of Owner, but in any event not less than one and one-half times the sum determined by Owner to be necessary, to pay for all labor, material, services or other claims which are then unpaid or which are then believed by Owner, in its reasonable discretion, to be unpaid. Upon final completion of the Work, Owner shall pay the remainder of the Contract Price as recommended by the City Engineer. 5. COMPLETION DATE. The Work must be completed by October 1, 2022. 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local laws and regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and Underground Facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by Owner and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. J. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the Owner the names of the Subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the Owner. (2) The Contractor is responsible to the Owner for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the Owner and any subcontractor. 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. 7. WORKER’S COMPENSATION. The Contractor shall obtain and maintain for the duration of this Contract, statutory Worker’s Compensation Insurance and Employer’s Liability Insurance as required under the laws of the State of Minnesota. 8. COMPREHENSIVE GENERAL LIABILITY. Contractor shall obtain the following minimum insurance coverage and maintain it at all times throughout the life of the Contract, with the City included as an additional name insured on the general liability insurance on a primary and noncontributory basis. The Contractor shall furnish the City a certificate of insurance satisfactory to the City evidencing the required coverage: Bodily Injury: $1,000,000 each occurrence $1,000,000 aggregate products and completed operations Property Damage: $1,000,000 each occurrence $1,000,000 aggregate Contractual Liability (identifying the contract): Bodily Injury: $1,000,000 each occurrence Property Damage: $1,000,000 each occurrence $1,000,000 aggregate Comprehensive Automobile Liability (owned, non-owned, hired): Bodily Injury: $1,000,000 each occurrence $1,000,000 each accident Property Damage: $1,000,000 each occurrence 9. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 10. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 11. PERFORMANCE AND PAYMENT BONDS. Performance and payment bonds are not required for the doing of any public work if the contract price is $175,000 or less. On projects of more than $175,000 for the doing of public work a payment bond and a performance bond each in the amount of the contract price must be furnished to the City prior to 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 commencement of work. The form of the bonds must satisfy statutory requirements for such bonds. 12. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. Owner and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any law or regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon Owner and Contractor, who agree that the Contract Documents shall be reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Software License. If the equipment provided by the Contractor pursuant to this Contract contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Patented devices, materials and processes. If the Contract requires, or the Contractor desires, the use of any design, device, material or process covered by letters, patent or copyright, trademark or trade name, the Contractor shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the Owner. If no such agreement is made or filed as noted, the Contractor shall indemnify and hold harmless the Owner from any and all claims for infringement by reason of the use of any such patented designed, device, 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 material or process, or any trademark or trade name or copyright in connection with the Project agreed to be performed under the Contract, and shall indemnify and defend the Owner for any costs, liability, expenses and attorney's fees that result from any such infringement. G. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Contract without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. H. Waiver. In the particular event that either party shall at any time or times waive any breach of this Contract by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Contract by either party, whether of the same or any other covenant, condition or obligation. I. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Contract. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. J. Severability. If any provision, term or condition of this Contract is found to be or become unenforceable or invalid, it shall not effect the remaining provisions, terms and conditions of this Contract, unless such invalid or unenforceable provision, term or condition renders this Contract impossible to perform. Such remaining terms and conditions of the Contract shall continue in full force and effect and shall continue to operate as the parties’ entire contract. K. Entire Agreement. This Contract represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. L. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of- way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. M. If the work is delayed or the sequencing of work is altered because of the action or inaction of the Owner, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. 140400v01 RNK:08/06/2010 ENG 22-17NB Engineering 2/7/2014 CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ___________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.D. To:Mayor and City Council Item Type: Request For Purchase From:Chad A. Millner, P.E., Director of Engineering Item Activity: Subject:Request for Purchase: Sanitary Sewer Lift Station No. 6 Construction Phase Services Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Sanitary Sewer Lift Station No. 6 Construction Phase Services with Barr Engineering for $416,000. INTRODUCTION: Capital Improvement Plan P roject No.19338 proposes the replacement of lift station No. 6 with a new station. Lift station No. 6 is a major component of the sanitary conveyance system. The professional services will manage the construction portion of the project. ATTACHMENTS: Description Request for Purchase: Sanitary Sewer LS No. 6 Construction Phase Services LS No. 6 Construction Phase Services Proposal Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100162 Department: Engineering Buyer: Chad Millner Date: 07/19/2022 Requisition Description: Sanitary Lift Station No 6 Construction Phase Services Vendor: BARR ENGINEERING CO Cost: $416,000.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:SERVIC K - SERVICE CONTRACT DESCRIPTION: Capital Improvement Plan Project No 19338 proposes the replacement of lift station 6 LS6 with a new station. LS6 is a major component of the sanitary conveyance system. The professional services will manage the construction portion of the project. BUDGET IMPACT: This project will be funded from the sanitary sewer utility fund. 2 COMMUNITY IMPACT: This lift station provides sanitary sewer service to approximately 2/3rds of the city. It is a vital piece of infrastructure to support the sanitary sewer service. ENVIRONMENTAL IMPACT: Sustainability was considered during the design process. Barr Engineering Co. 4300 MarketPointe Drive, Suite 200, Minneapolis, MN 55435 952.832.2600 www.barr.com June 22, 2022 Mr. Ross Bintner City of Edina 7450 Metro Blvd. Edina, MN 55439 Re: LS-6 Construction Phase Services and Modify Design Phase Services (#2) Dear Ross: We appreciate the continued opportunity to provide engineering services related to the update of lift station 6 (LS-6). We have prepared the following request for an increase in engineering fees to cover additional final design costs along with anticipated scope of services for the construction phase. During development of the final design documents, the amount of engineering hours to date has exceeded the amount previously estimated. As we have previously discussed work completed beyond our original scope including landscaping design, new water service to the building, building plumbing, research and demonstration of sustainability programs, peak shaving generator evaluation, addition of Vapex odor control equipment, and preparing front end construction contracts on behalf of the City using the contract documents included in the bidding document. In addition, the number of planned drawings at 30% design (~36) compared to the number in the final design (53) was more than anticipated. For the construction phase, we anticipate providing the following services: • Facilitate preconstruction, weekly construction progress, and closeout meetings during the construction • Review equipment and material submittals (shop drawings) to determine compliance with the design concept of the project • Respond to requests for information (RFIs) • Process field orders, if necessary • Negotiate and process change orders, if necessary (assumes 5) • Provide clarifications and interpretation of the plans and specifications • Provide construction observation o Full time during underground infrastructure construction activities (40 hours/week for 24 weeks) o Part time during above grade work (when not onsite for full time) and on-call for engineers of record (16 hours/week for 28 weeks) • Retain CBS2 to perform architectural services related to construction including submittal review, answering contractor RFIs, and up to two site visits. • Review laboratory tests to determine suitability of construction materials • Review contractor payment application requests Mr. Ross Bintner June 22, 2022 Page 2 W:\Business Units\ED\Proposals\2022\P256.22 City of Edina Lift Station 6\Construction Services Proposal Letter_No 2.docx • Coordinate with City-designated independent laboratory providing testing of materials as part of a QA/QC program, if necessary, during the construction phase • Prepare punch-list, conduct final inspection, and make recommendations for final acceptance and payment • Prepare construction record drawings from contractor field notes and Barr’s construction observation notes • Project management services and overall coordination to ensure successful project execution and City satisfaction. Construction phase deliverables: • Submittal and RFI responses • Change orders • Construction observation field notes and photographs • Meeting notes • Electronic copy of final punch list • AutoCAD and PDF files of record drawings Construction phase assumptions: • Construction will be completed within one year from notice to proceed • Underground infrastructure construction will last for 24 weeks • Construction material testing services will be provided by the City • Construction staking and survey will be provided by the City • Approval of contractor payment application and/or change orders will be provided by the City Although our intent is to complete the project within the identified scope, schedule and budget, this project relies primarily on contractor construction execution and completion per the schedule in the contract documents. This schedule may vary due to unforeseen circumstances, particularly related to interruptions in the supply chain, COVID-19 impacts and other unforeseen conditions. We will notify you of changes when we become aware of them. Below is a summary of our request: Scope Item Requested Fee Final Design Additions $66,000 Construction Phase $350,000 Total Requested Fee Increase $416,000 Original Contract Amount (plus CO1) $294,500 Total Contract Amount $710,500 Please let me know if you would like additional information regarding this request. Mr. Ross Bintner June 22, 2022 Page 3 W:\Business Units\ED\Proposals\2022\P256.22 City of Edina Lift Station 6\Construction Services Proposal Letter_No 2.docx Sincerely yours, BARR ENGINEERING CO. Julia Macejkovic Its Vice President Accepted this ____________ day of ___________________, 20____ City of Edina By Date: August 3, 2022 Agenda Item #: VI.E. To:Mayor and City Council Item Type: Request For Purchase From:Chad A. Millner, P.E., Director of Engineering Item Activity: Subject:Request for Purchase: Sanitary Sewer Lift Station No. 3 Construction Phase Services Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Sanitary Sewer Lift Station No. 3 Construction Phase Services with Bolton & Menk for $80,480. INTRODUCTION: Construction services for lift station No. 3 replacement include construction observation, administration, staking, electrical and structural support, management, and record drawings. ATTACHMENTS: Description Request for Purchase: Construction Phase Services LS No. 3 Replacement Letter Proposal LS No. 3 Construction Phase Services Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100160 Department: Engineering Buyer: Chad Millner Date: 07/05/2022 Requisition Description: Construction Services Lift Station 3 Replacement Vendor: BOLTON & MENK INC Cost: $80,480.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:SERVIC K - SERVICE CONTRACT DESCRIPTION: Construction services for lift station 3 replacement. Services include construction observation, administration, staking, electrical and structural support, management, and record drawings. BUDGET IMPACT: This project is funded from the sanitary sewer fund and detailed in CIP Project No. 19-339. Additional funds are being utilized for the capital replacement of the lift station from savings associated with the 2020 SCADA Project and the 2021 Street Reconstruction Projects. 2 ENVIRONMENTAL IMPACT: Engineering services has little environmental impact. Staff ensured the deign of the lift station accounts for the City's sustainability goals. This type of infrastructure does use natural resources and energy to operate. N:\Proposals\Edina\LS #3\Lift Station #3 Construction Services Proposal 2022 0701.docx July 5, 2022 Mr. Ross Bintner, P.E., Engineering Services Manager City of Edina – Engineering Department 7450 Metro Boulevard Edina, MN 55439 RE: SUPPLEMENTAL LETTER AGREEMENT Lift Station #3 – Construction Services City of Edina, Minnesota Dear Mr. Bintner, Bolton & Menk, Inc. is pleased to present this proposal to you for professional engineering services in support of the Construction Phase of the Lift Station #3 Improvements. As a part of this proposal, we describe our understanding of the project, detail our proposed scope of work, and provide our fees for service. This proposal is being offered as a Supplemental Agreement to our June 18, 2013 Master Agreement for Professional Engineering Services with the City of Edina. PROJECT UNDERSTANDING Bolton & Menk completed final plans for the City of Edina’s Lift Station #3 Improvements in June. The project is set to bid mid-July with construction starting as early as Fall 2022, with substantial completion August 29, 2023. As the project moves into construction, the city is requesting Construction Services throughout the construction phase. SCOPE OF WORK The City of Edina is requesting Construction Administration, Observation, & Staking services in support of the LS #3 Improvement Project. Bolton & Menk proposes part-time construction observation, we will be in close communication with the City’s Contractor throughout construction to ensure that our construction observer (RPR) is onsite for critical work on the project. While the contractor is on site working, we expect most days our RPR will be stopping by the site for a couple of hours to check on construction activities, answer questions, and document progress. During days when more detailed underground utility work and connections to existing infrastructure in occurring, our RPR will be onsite closer to full-time. Lift Station #3 – Construction Services Proposal July 5, 2022 Page 2 Bolton & Menk’s RPR will review attend the preconstruction meeting and any construction-related meetings, serve as a liaison between city and contractor, review shop drawings, and verify work is being completed in accordance with the contract documents. We have estimated 250 hours for our construction observation. Construction administration will include conducting the preconstruction meeting and construction check-in meetings, reviewing shop drawings, addressing contractor questions, monitoring schedule, coordination and oversight of the RPR, and preparation of pay requests. We have estimated 115 hours for construction administration. Bolton & Menk will complete construction staking for the project including 3-trips to the site to stake silt fence, lift station structures, building pad, retaining wall, bituminous driveway and site grading. For estimating purposes we have estimated 18 hours for construction staking. Electrical and structural shop drawing review and oversight is estimated at 48 hours. Construction management and Quality Assurance will be completed by myself and Seth Peterson. We’ve also anticipated assistance with preparing record drawings at 16 hours, we will take the information provided by the Contractor and our RPR, that is gathered during construction, and prepare record drawings. Bolton & Menk, Inc. shall not supervise, direct, or have control over the contractor’s work. Bolton & Menk, Inc. shall not be responsible for the means, methods, procedures, techniques, or sequences of construction, nor for the safety on the job site. Lift Station #3 – Construction Services Proposal July 5, 2022 Page 3 PROJECT FEES Because the engineer has no direct control over the scheduling or operations of the project contractor, construction phase services described in this proposal are proposed to be provided on an hourly basis. The estimated total fee for construction services described in this proposal for work beginning after the bid opening and going through project close-out is $80,480. Estimates for the work described above are as follows: Construction Observation $ 37,500 Construction Administration $ 19,550 Construction Staking $ 4,500 Electrical and Structural Support $ 10,530 Construction Management $ 6,000 Record Drawings $ 2,400 Total Estimated Construction Fee $ 80,480 If you find this proposal satisfactory, your signature of this proposal will constitute acceptance of the terms outlined and your authority for us to proceed. Please call if you wish to discuss this proposal. We look forward to providing these professional engineering services to you on this project and appreciate your consideration of Bolton & Menk, Inc. Sincerely, Bolton & Menk, Inc. Sarah E. Lloyd, P.E. Principal Engineer ______________________________________ ______________________________ Signed Date _________________________________________ Printed Name Date: August 3, 2022 Agenda Item #: VI.F. To:Mayor and City Council Item Type: Request For Purchase From:Ross Bintner P.E., Engineering Services Manager Item Activity: Subject:Request for Purchase: Sanitary Sewer Lift Station No. 6 Replacement Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Sanitary Sewer Lift Station No. 6 Replacement with Mangey Construction, Inc. for $7,558,400.00 INTRODUCTION: Capital Improvement Plan P roject No 19-338 proposes the replacement of lift station 6 with a new lift station. Lift station #6 is a major component of the sanitary conveyance system. T he facility is due for replacement versus rehabilitation. ATTACHMENTS: Description Request for Purchase: Sanitary Sewer Lift Station No. 6 Replacement Contract ENG 22-15 Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100181 Department: Engineering Buyer: Chad Millner Date: 07/26/2022 Requisition Description: Sanitary Lift Station No 6 Replacement Vendor: Magney Construction, Inc. Cost: $7,558,400.00 REPLACEMENT or NEW: REPLACEM - REPLACEMENT PURCHASE SOURCE: QUOTE/BID DESCRIPTION: Capital Improvement Plan Project No 19-338 proposes the replacement of lift station 6 with a new lift station. Lift station is a major component of the sanitary conveyance system. The facility is due for replacement versus rehabilitation. BUDGET IMPACT: This project will be funded from the sanitary sewer utility fund. The bid was substantially higher then expected. Staff has determined this is a reasonable price for the current market and recommends award of a contract. The contractor has provided ideas to lower the overall cost of the project through value engineering. Staff and the contractor will develop Change Order #1 to reduce the overall contract amount after all the ideas have been vetted. 2 COMMUNITY IMPACT: This lift station provides sanitary sewer service to approximately 2/3rds of the city. It is a vital piece of infrastructure to support the sanitary sewer service. ENVIRONMENTAL IMPACT: Sustainability was considered during the design process. 1 1/2015 ENG 22-15 CONTRACT NO. ENG 22-15 THIS AGREEMENT made this 3rd day of August, 2022, by and between the CITY OF EDINA, a Minnesota municipal corporation (“City”) and Magney Construction, 1401 Park Road, Chanhassen, MN 55317 (“Contractor”). City and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Instructions to Bidders. C. City of Edina General Contract Conditions. D. Addenda number 1. E. Specifications prepared by Chad A. Millner, P.E., dated June 8, 2022. F. Plan sheets numbered 1 to 54. G. Performance Bond. H. Payment Bond. I. Responsible Contractor Verification of Compliance J. Contractor’s Bid dated July 7, 2022. The Contract Documents are to be read and interpreted as a whole. The intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Work and to require Contractor to provide the highest quality and greatest quantity consistent with the Contract Documents. If there are inconsistencies within or among part of the Contract Documents or between the Contract Documents and applicable standards, codes or ordinances, the Contractor shall provide the better quality or greater quantity of Work or comply with the more stringent requirements. 1.1 Before ordering any materials or doing any Work, the Contractor shall verify measurements at the Project site and shall be responsible for the correctness of such measurements. No extra charges or compensation will be allowed on account of differences between actual dimensions and the dimensions indicated on the Drawings. Any difference that may be found shall be submitted to the City for resolution before proceeding with the Work. 1.2 If a minor change in the Work is necessary due to actual field conditions, the Contractor shall submit detailed drawings of such departure to the City for approval before making the change. The City shall not be required to make any adjustment to either the Contract Sum or Contract Time because of any failure by the Contractor to comply with the requirements of this paragraph. Actual or alleged conflicts or inconsistencies between the Plans and Specifications or other Contract Documents shall be brought to the City’s attention in writing, prior to performing the affected Work. The City’s directions shall be followed by the Contractor. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. OBLIGATIONS OF THE CITY. The City agrees to pay and the Contractor agrees to receive and accept payment in accordance with the Contractor’s bid $7,558,400.00. 2 1/2015 ENG 22-15 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by City as provided in the General Conditions. B. Progress Payments; Retainage. City shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1½ percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, City shall pay the remainder of the Contract Price as recommended by City. 5. COMPLETION DATE. The Work must be completed and ready for final payment by August 31, 2023. 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions; and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and underground facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, 3 1/2015 ENG 22-15 sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by City and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the City the names of the subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the City. (2) The Contractor is responsible to the City for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the City and any subcontractor. (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. 7. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the bid shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 8. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 9. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. City and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon City and Contractor, who agree that the Contract Documents shall be reformed to replace such 4 1/2015 ENG 22-15 stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Copyright/Patent. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. If the equipment provided by the Contractor pursuant to this Agreement contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Agreement without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. G. Waiver. In the particular event that either party shall at any time or times waive any breach of this Agreement by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Agreement by either party, whether of the same or any other covenant, condition or obligation. H. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Agreement. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. I. Severability. If any provision, term or condition of this Agreement is found to be or becomes unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Agreement, unless such invalid or unenforceable provision, term or condition renders this Agreement impossible to perform. Such remaining terms and conditions of the Agreement shall continue in full force and effect and shall continue to operate as the parties’ entire agreement. J. Entire Agreement. This Agreement represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. K. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of-way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. L. If the work is delayed or the sequencing of work is altered because of the action or inaction of the City, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. 5 1/2015 ENG 22-15 M. Responsible Contractor. This contract may be terminated by the City at any time upon discovery by the City that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn Stat. § 16C.285, subd. 3. CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ____________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.G. To:Mayor and City Council Item Type: Request For Purchase From:Ross Bintner P.E., Engineering Services Manager Item Activity: Subject:Request for Purchase: Sanitary Sewer Lift Station No. 3 Replacement Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Sanitary Sewer Lift Station No. 3 Replacement with Geislinger and Sons for $1,607,000. INTRODUCTION: This project will remove and replace sanitary lift station #3 in its current location. The existing condition of the facility requires replacement versus any sort of rehabilitation plan. ATTACHMENTS: Description Request for Purchase: Sanitary Sewer Lift Station No. 3 Replacement Contract ENG 21-3 Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100180 Department: Engineering Buyer: Chad Millner Date: 07/26/2022 Requisition Description: Sanitary Sewer Lift Station #3 Replacement Vendor: GEISLINGER & SONS Cost: $1,607,000.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE: QUOTE/BID DESCRIPTION: This project will remove and replace sanitary sewer lift station #3. BUDGET IMPACT: This project is funded from the sanitary sewer fund and detailed in CIP Project No. 19-339. Additional funds are being utilized for the capital replacement of the lift station from savings associated with the 2020 SCADA Project and the 2021 Street Reconstruction Projects. Bid came in higher than anticipated but staff feels the bid amount is the market price and the facility needs to be replaced. 2 ENVIRONMENTAL IMPACT: Staff ensured the deign of the lift station accounts for the City's sustainability goals. This type of infrastructure does use natural resources and energy to operate. 1 1/2015 ENG 21-3 CONTRACT NO. ENG 21-3 THIS AGREEMENT made this 3rd day of August, 2022, by and between the CITY OF EDINA, a Minnesota municipal corporation (“City”) and Geislinger and Sons, Inc., 511 Central Ave S, Watkins, MN 55389, (“Contractor”). City and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Instructions to Bidders. C. City of Edina General Contract Conditions. D. Addenda number 1 and 2. E. Specifications prepared by Jacob E. Humburg, dated June 13, 2022 and approved by Chad A. Millner, P.E., dated June 21, 2022. F. Plan sheets numbered 1 to 18. G. Performance Bond. H. Payment Bond. I. Responsible Contractor Verification of Compliance J. Contractor’s Bid dated July 11, 2022. The Contract Documents are to be read and interpreted as a whole. The intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Work and to require Contractor to provide the highest quality and greatest quantity consistent with the Contract Documents. If there are inconsistencies within or among part of the Contract Documents or between the Contract Documents and applicable standards, codes or ordinances, the Contractor shall provide the better quality or greater quantity of Work or comply with the more stringent requirements. 1.1 Before ordering any materials or doing any Work, the Contractor shall verify measurements at the Project site and shall be responsible for the correctness of such measurements. No extra charges or compensation will be allowed on account of differences between actual dimensions and the dimensions indicated on the Drawings. Any difference that may be found shall be submitted to the City for resolution before proceeding with the Work. 1.2 If a minor change in the Work is necessary due to actual field conditions, the Contractor shall submit detailed drawings of such departure to the City for approval before making the change. The City shall not be required to make any adjustment to either the Contract Sum or Contract Time because of any failure by the Contractor to comply with the requirements of this paragraph. Actual or alleged conflicts or inconsistencies between the Plans and Specifications or other Contract Documents shall be brought to the City’s attention in writing, prior to performing the affected Work. The City’s directions shall be followed by the Contractor. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 2 1/2015 ENG 21-3 3. OBLIGATIONS OF THE CITY. The City agrees to pay and the Contractor agrees to receive and accept payment in accordance with the Contractor’s bid $1,607,000.00. 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by City as provided in the General Conditions. B. Progress Payments; Retainage. City shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1½ percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, City shall pay the remainder of the Contract Price as recommended by City. 5. COMPLETION DATE. The Work must be completed and ready for final payment by September 29, 2023. 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions; and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions 3 1/2015 ENG 21-3 (surface, subsurface, and underground facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by City and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the City the names of the subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the City. (2) The Contractor is responsible to the City for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the City and any subcontractor. (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. 7. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the bid shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 8. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 9. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. City and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. 4 1/2015 ENG 21-3 C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon City and Contractor, who agree that the Contract Documents shall be reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Copyright/Patent. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. If the equipment provided by the Contractor pursuant to this Agreement contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Agreement without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. G. Waiver. In the particular event that either party shall at any time or times waive any breach of this Agreement by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Agreement by either party, whether of the same or any other covenant, condition or obligation. H. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Agreement. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. I. Severability. If any provision, term or condition of this Agreement is found to be or becomes unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Agreement, unless such invalid or unenforceable provision, term or condition renders this Agreement impossible to perform. Such remaining terms and conditions of the Agreement shall continue in full force and effect and shall continue to operate as the parties’ entire agreement. J. Entire Agreement. This Agreement represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. K. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of-way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. 5 1/2015 ENG 21-3 L. If the work is delayed or the sequencing of work is altered because of the action or inaction of the City, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. M. Responsible Contractor. This contract may be terminated by the City at any time upon discovery by the City that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn Stat. § 16C.285, subd. 3. CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ____________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.H. To:Mayor and City Council Item Type: Request For Purchase From:Rachel Finberg, Project Manager Item Activity: Subject:Request for Purchase: 69th Street Well House No. 5 Exterior Improvements Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for 69th Street Well House No. 5 Exterior Improvements with JPMI Construction Co. for $298,500. INTRODUCTION: This City of Edina wishes to make improvements to Well House No. 5 building envelope and exterior to better comply with the Greater Southdale District Design Guidelines. This is part of capital improvement project ENG21034. Work will also include some upgrades to interior mechanical, electrical, and plumbing systems. The work will include furnishing labor, equipment, and materials necessary to complete the project as specified by Oertel Architects. ATTACHMENTS: Description Request for Purchase: 69th Street Well House No. 5 Exterior Improvements JPMI Construction Contract Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12200177 Department:Engineering Buyer:Rachel Finberg Date: 07/25/2022 Requisition Description:69th Street Well House #5 Exterior Improvements Vendor:JPMI CONSTRUCTION CO Cost:$298,500.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:QUOTE/BD - QUOTE/BID DESCRIPTION: This City of Edina wishes to make improvements to Well #5 building envelope and exterior in order to better comply with the Southdale District Design Guidelines. This is part of capital improvement project ENG21034. Work will also include some upgrades to interior mechanical, electrical, and plumbing systems. The work shall consist of furnishing labor, equipment, and materials necessary to complete the project per the specifications provided by Oertel Architects. BUDGET IMPACT: The project is funded from CIP #ENG21034 and Improvement # WM-598. The bids came in slightly higher than the anticipated budget. The contractor assisted staff in value engineering the project to save approximately $50,000 from the original bid. The contract amount is the lower agreed upon contract value. 2 COMMUNITY IMPACT: The project design considered the Southdale District Design Guidelines. ENVIRONMENTAL IMPACT: This seasonal well house is used to supplement pumping and city needs during peak water usage. Remodeling and updating the structure will reduce demolition and disposal costs and waste as well as retain infrastructure value. APRIL 2018 D-1 IB WELL HOUSE 5 EXTERIOR IMPROVEMENTS CONTRACT NO ENG 22-16. THIS AGREEMENT made this 3rd_ day of _August_, 2022___, by and between the CITY OF EDINA, a Minnesota municipal corporation (“City”) and _JPMI_Contruction_Co_ (“Contractor”). City and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Instructions to Bidders. C. City of Edina General Contract Conditions. D. Addenda numbers _1_ to _4_. E. Specifications prepared by _Oertel Architects_ dated __June 9th, 2022_. F. Plan sheets numbered _1_ to _16_. G. Plan revision sheets dated __July 15th, _2022, numbered __1_ to _8__. H. Performance Bond. I. Payment Bond. J. Responsible Contractor Verification of Compliance K. Contractor’s Bid dated _July_7th,_2022_. Contractor Deduct for PR #1 dated __July 19th_2022__. The Contract Documents are to be read and interpreted as a whole. The intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Work and to require Contractor to provide the highest quality APRIL 2018 D-2 IB and greatest quantity consistent with the Contract Documents. If there are inconsistencies within or among part of the Contract Documents or between the Contract Documents and applicable standards, codes or ordinances, the Contractor shall provide the better quality or greater quantity of Work or comply with the more stringent requirements. 1.1 Before ordering any materials or doing any Work, the Contractor shall verify measurements at the Project site and shall be responsible for the correctness of such measurements. No extra charges or compensation will be allowed on account of differences between actual dimensions and the dimensions indicated on the Drawings. Any difference that may be found shall be submitted to the City for resolution before proceeding with the Work. 1.2 If a minor change in the Work is necessary due to actual field conditions, the Contractor shall submit detailed drawings of such departure to the City for approval before making the change. The City shall not be required to make any adjustment to either the Contract Sum or Contract Time because of any failure by the Contractor to comply with the requirements of this paragraph. Actual or alleged conflicts or inconsistencies between the Plans and Specifications or other Contract Documents shall be brought to the City’s attention in writing, prior to performing the affected Work. The City’s directions shall be followed by the Contractor. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. OBLIGATIONS OF THE CITY. The City agrees to pay and the Contractor agrees to receive and accept payment in accordance with the Contractor’s bid $_298,500_. 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by City as provided in the General Conditions. B. Progress Payments; Retainage. City shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1½ percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, City shall pay the remainder of the Contract Price as recommended by City. 5. COMPLETION DATE. The Work must be completed and ready for final payment by _May 1st 2023_. APRIL 2018 D-3 IB 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions; and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and underground facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by City and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the City the names of the subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the City. (2) The Contractor is responsible to the City for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the City and any subcontractor. (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. APRIL 2018 D-4 IB 7. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the bid shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 8. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 9. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. City and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon City and Contractor, who agree that the Contract Documents shall be reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Copyright/Patent. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. If the equipment provided by the Contractor pursuant to this Agreement contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Agreement without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. G. Waiver. In the particular event that either party shall at any time or times waive any breach of this Agreement by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Agreement by either party, whether of the same or any other covenant, condition or obligation. H. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Agreement. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. APRIL 2018 D-5 IB I. Severability. If any provision, term or condition of this Agreement is found to be or becomes unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Agreement, unless such invalid or unenforceable provision, term or condition renders this Agreement impossible to perform. Such remaining terms and conditions of the Agreement shall continue in full force and effect and shall continue to operate as the parties’ entire agreement. J. Entire Agreement. This Agreement represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. K. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of-way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. L. If the work is delayed or the sequencing of work is altered because of the action or inaction of the City, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. M. Responsible Contractor. This contract may be terminated by the City at any time upon discovery by the City that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn Stat. § 16C.285, subd. 3. CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ____________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.I. To:Mayor and City Council Item Type: Request For Purchase From:Noah Silver, Electrical/HVAC Supervisor Item Activity: Subject:Request for Purchase: Traffic Control Cabinet for 76th & Edinborough Way Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Traffic Control Cabinet for 76th & Edinborough Way from Traffic Control Corporation for $36,295. INTRODUCTION: The existing traffic control cabinet has reached its service life. Legacy control components are no longer available for replacement. The new control cabinet will ensure safe and reliable traffic control at this intersection. ATTACHMENTS: Description Request for Purchase: 76th & Edinborough Way Traffic Control Cabinet Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12200174 Department:Engineering Buyer:Noah Silver Date: 07/22/2022 Requisition Description:76th and Edinborough Way Traffic Control Cabinet Vendor:TRAFFIC CONTROL CORPORATION Cost:$36,295.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:STATE K - STATE CONTRACT DESCRIPTION: The existing traffic control cabinet has reached its service life. Legacy control components are no longer available for replacement. The new control cabinet will ensure safe and reliable traffic control at this intersection. BUDGET IMPACT: The equipment is funding from operating budget for traffic signal repair and maintenance. 2 COMMUNITY IMPACT: In addition to providing safe and reliable traffic control, the pedestrian call buttons and mounting hardware will be upgraded to an ADA compliant system with audible crossing instructions. ENVIRONMENTAL IMPACT: The existing aluminum cabinet and control components will be recycled. New control components utilize a similar amount of electricity compared to the existing equipment. Date: August 3, 2022 Agenda Item #: VI.J. To:Mayor and City Council Item Type: Request For Purchase From:Chad A. Millner, P.E., Director of Engineering Item Activity: Subject:Request for Purchase: Bury Overhead Power Lines on the Blake Road Project Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase with Northern States Power (Xcel Energy) for $366,728 to bury overhead power lines on the Blake Road project. INTRODUCTION: The Blake Road Street Reconstruction Project has many competing priorities. T he design that minimize impacts while still meeting many of the priorities does not create space for overhead power. Therefore, a request was made to Xcel to bury the power lines. This is not a typical service of street reconstruction but the existing topography of this project requires actions that are not typical. Staff recommends approval. ATTACHMENTS: Description Request for Purchase: Bury Overhead Power Lines on the Blake Road Project Xcel Energy Agreement Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12200175 Department:Engineering Buyer:Chad Millner Date: 07/22/2022 Requisition Description:Blake Road Project: Bury Overhead Power Lines Vendor:NORTHERN STATES POWER COMPANY, MINNESOTA Cost:$366,728.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE:SERVIC K - SERVICE CONTRACT DESCRIPTION: The project involves burying overhead power lines along the reconstruction of 1.0 mile of municipal state aid asphalt streets, construction of a mini roundabout and street lighting at the Interlachen Boulevard intersection, replacement of existing concrete curb and gutter, installation of new concrete curb and gutter, construction of new concrete on-street bike lanes, shared use path and walk, localized rehabilitation of the sanitary sewer, watermain and storm sewer systems in the neighborhood. The project area includes Blake Road between Scriver Road and Spruce Road, and a portion of Interlachen Boulevard east of Blake Road. BUDGET IMPACT: Project funded from Municipal State Aid Funds. 2 COMMUNITY IMPACT: This project will improve aesthetics and create more resilient power system. ENVIRONMENTAL IMPACT: This project will remove the need to trim trees as they come in contact with the overhead power lines. Some tree clearing is necessary but most areas align with the street reconstruction impacts. Updated 03/08/2021 Account No. XX-0014116742-X Job No. 13063934 Job Address BLAKE RD OH-UG Northern States Power Company - Minnesota EDINA, MN 55349 5505 COUNTY ROAD 19 SHOREWOOD, MN 55331 July 1, 2022 Dear City Of Edina, Thank you for choosing Xcel Energy to be your energy provider. We appreciate your business, and our goal is to deliver you reliable service at an affordable price. This letter contains important information about your requested service. Please read all details below as well as any accompanying information and respond accordingly to ensure your project is completed accurately and timely. This letter relates to your request for: ➢ Overhead to Underground conversion Your portion of the cost of this project is $178,364.00. A hard copy invoice will be sent to you via U.S. Mail Postal Service in the coming days. Please see the attached payment options document for more instructions. Upon receipt of payment and other required documentation as noted below, your project will be scheduled and you will be notified of the scheduled date. If paying by check, please note the account number identified at the top of this letter on your check to ensure accurate and timely payment processing. Below is a list of additional documentation that you will need to review, sign, and return to the Xcel Energy Designer by email or U.S. Postal Service to their address listed at the bottom of the letter. Please retain a copy of all documentation for your records. ➢ Documents to be returned to Xcel Energy: □ Municipal Statement of Work ➢ Additional enclosures: □ Payment Options If you have any questions about the enclosures or about your specific job, please contact Traci Carlson at 952- 470-3343 and reference your account number and/or job number above. We look forward to being your energy provider. Sincerely, Traci Carlson DESIGNER II DISTRIBUTION 5505 COUNTY ROAD 19 SHOREWOOD, MN 55331 Xcel Energy traci.n.miest@xcelenergy.com Page 1 of 2 Updated 03/08/2021 Customer Payment Options Xcel Energy offers seven payment options to pay for your construction project. Please select the payment options that work best for you. Payment options listed in order of quickest processing MyAccount/eBill™ Register at xcelenergy.com to make a payment from your checking account. You can also enroll in eBill and an email will let you know your bill is ready to view at the MyAccount site in place of receiving a mailed paper bill statement. MyAccount also provides a convenient list of your bill statement and payment history and retains your banking information for future use. Each additional account number will have to be added to your list of managed accounts within MyAccount. Pay by Phone Make payment from your checking or savings account at no charge by using our automated phone system. Please call us at 800.895.4999. Credit/Debit Card Payment All Xcel Energy residential and business customers are now eligible for payment via credit or debit card. Most major credit and debit cards accepted. Apple Pay or Google Pay is available to customers with a mobile device. To pay by phone, call our payment processing partner, Kubra EZ Pay, at 833.660.1365 To pay online, visit www.xcelenergy.com/billing_and_payment and click on the Pay with credit/debit card link to make an online credit/debit card payment through Kubra EZ Pay. Please note the current fees along with payment information: • Residential Customer Accounts o Payments accepted for up to $1,000 in a single transaction ▪ There is a $1.50 fee per transaction ▪ No fee for Wisconsin residential customer accounts • Non-Residential Customer Accounts o Payments accepted for up to $100,000 in a single transaction ▪ There is a 2.2% fee per transaction. All credit/debit card types allow a maximum 25 credit/debit card payments in a 28-rolling-day period, per Xcel Energy account, per credit/debit card. *If you receive this message: “The information provided does not match our records please try again,” while trying to make a payment, please try again the following day after 8am CST. Page 2 of 2 Updated 03/08/2021 Overnight Payment Delivery Options Send your payment and remittance stub including account number (written on the memo line of your check) via FedEx, UPS or USPS overnight delivery to: Xcel Energy Attn: Remittance Processing 414 Nicollet Mall, 3rd Floor Minneapolis, MN 55401-1993 Overnight delivery contact phone number: 612.330.5593 The following alternate zip-codes are also valid: Minneapolis, MN 55401-1927 Minneapolis, MN 55401-4993 In-Person Pay Stations Pay in-person at a location near you by visiting xcelenergy.com for pay station locations. Please include the account number on the memo line of your check. Please note: A $1.50 transaction fee applies. ($1.45 for Western Union only in Colorado) Pay by U.S Postal Service When sending payment by U.S. mail, please include the account number on the memo line of your check. Do not combine this payment with any other Xcel Energy bill payments. Mail check payments to: Xcel Energy P.O. Box 9477 Minneapolis, MN 55484-9477 Electronic Funds Transfer (EFT) (Only available to business) The Electronic Funds Transfer (EFT) payment process allows business customers to pay via Corporate Trade Exchange (CTX) formatted Automated Clearing House (ACH) (also referred to as EDI-820), the ability to electronically remit payment. The payments to Xcel Energy's bank accounts are initiated by the customer through a series of steps linked to the billing system. The CTX addenda records included with the funds transfer allow the posting of the payments to occur electronically to the account numbers provided by the customer. To obtain Xcel Energy’s EFT bank account numbers and to provide transfer confirmation, please email CustReceive@xcelenergy.com. Helpful hints to ensure accurate and timely processing of your payment: • For all payment options, please have your account number available and note on any payment documentation. • The hard copy invoice will be sent to you via U.S mail in the coming days. If you would like an electronic copy of our invoice prior to receiving the hard copy, please contact your Designer who is identified in the attached letter. • In order to apply payment to the correct account and avoid unnecessary delays, please make separate payments for each individual project or invoice. • Please note that depending on payment selection, it may take up to a few days to process your payment. DATE: STATEMENT OF WORK REQUESTED BY COUNTY, CITY, TOWN OR TOWNSHIP FOR PROJECTS WITH ESTIMATED CONSTRUCTION COSTS OVER $25,000 07/01/22 WORK REQUESTED BY:CITY OF EDINA ("Municipality") WORK LOCATION:BLAKE RD OVERHEAD TO UNDERGROUND CONVERSION ADDRESS:7450 METRO BLVD EDINA, MN 55439 CONSISTING OF: The following shall constitute the "Work" to be performed by Xcel Energy: THE OVERHEAD TO UNDERGROUND CONVERSION ALONG BLAKE RD FROM WATERMAN AVE TO JUST EAST OF ROUND ABOUT AND SOUTH ALONG BLAKE RD TO SCRIVER RD. FACILITIES TO BE INSTALLED FOR UNDER GROUND INCLUDE FEEDER CABLE ALONG WITH THREE PHASE AND SINGLE PHASE CABLE TO FEED TAPS AND CUSTOMERS ALONG THE ROUTE. TWO PMH SWITCH CABINETS, 1 3PH LBC, SIX TERMINAL POLES AND THREE 1PH PADMOUNT TRANSFORMERS. CABLE TO BE INSTALLED BY DIRECTIONAL BORING. Since the City of Edina is requesting Xcel Energy to relocate/bury facilities, Xcel Energy will need to make necessary changes to our system to meet our operating standards. Municipality agrees to pay Xcel Energy for Xcel Energy's actual total cost of the Work, subject to the Municipality's right of cost review in accordance with the terms of this Statement of Work ("Statement"). The current estimate for the Work is $366,728.00 ("Estimate"). The estimate is compromised of the following major components: Component Sub-estimate FINAL ESTIMATE: $366,728 - $10,000 (ENGINEERING FEE ALREADY PAID)= $356,364 A) INSTALL 2 PMH SWITCHGEAR FOR FEEDER LEVEL CABLES B) INSTALL 3PH LBC TO FEED TAPS C) REPLACE 3 OVERHEAD TRANSFORMERS WITH SINGLE PHASE PADMOUNTED TRANSFORMERS D) CITY IS RESPOSIBLE FOR CONVERTING RESIDENTIAL SERVICES FROM OVERHEAD TO UNDERGROUND AT 5100 LAKE RIDGE RD, 5108 SCRIVER RD, 5111 SCRIVER RD AND FOR BRINGING IN EXISTING CUSTOMER OWNED SERVICE AT 5101 INTO NEW SECONDARY PEDESTAL. Total: The undersigned herby requests and authorizes Xcel Energy to perform the Work. In consideration thereof and in lieu of a City Requested Facilities Sucharge, the City agrees to pay Xcel Energy on the ("Statement"). The current estimate for the Work is ($178,364.00 ) which is fifty (50) percent of the Estimate ("Down Payment"). All Work shall be performed pursuant to good utility practice (as that term is generally understood in the utility industry) utilizing Xcel Energy's commercially reasonable efforts to complete the Work within the Estimate under Xcel Energy's then current design standards, operating procedures, and safety procedures. The facillities installed or removed by Xcel Energy shall be the property of Xcel Energy and any payment by Municipality shall not entitle Municipality to any ownership interest or right therin. Municipality's and Xcel Energy's rights and obligations with respect to the facillities and services provided through the facilities are subject to the terms of this Statement, as well as the additional terms and conditions provided in the Xcel Energy Electric Rate Book, as now exists or may hereafter be changed, on file with the Minnesota Public Utilities Commision. Payment of $ In advance of the Work, Muncipality agrees to inform Xcel Energy of any Municipality-related or other projects that may affect the Work. During the Work, Xcel Energy agrees to provide the Muncipality notice of any proposed change orders increasing the cost of the Work. Municipality acknowledges that change orders that result from request of Municipality with respect to the performance of the Work or the scope of the Work may increase Xcel Energy's acutal cost of the Work. Upon Completion of the Work, Xcel Energy agrees to provide Municipality with final detal of the actual work performed and the actual costs of such work performed. Xcel Energy will identify any information included in such information that is non-public pursuant to Minn. Stat. Ch. 13. Upon request by Muncipality, Xcel Energy shall provide Muncipality the opportunity to review more detailed documentation of the Work performed and related costs. Xcel Energy agrees to keep Municipality reasonably informed with respect to Xcel Energy's performance of the Work, consistent with good utility practice and will, at minimum, apprise Municipality when half of the Estimate has been spent and when ninety percent of the Estimate has been spent. Xcel Energy also agrees to timely nortify the Municipality when the Work is substantially complete. Upon receipt of the invoice for the cost balance, the City shall have the right to require that Xcel Energy provide reasonable cost support documentation, including change orders, for its actual total cost of the Work. The Municipality shall pay the balance of cost not subject to reasonable dispute within the timeframe set forth in the Minnesota Municipal Prompt Payment Act, Minn. Stat. 471-425. Xcel Energy and Municipality shall reasonably try to resolve any disputes with respect to costs incurred in performance of the Work in good faith. In the event Xcel Energy and Municipality are unable to resolve any such disputes, the parties may seek redress in a forum with jurisdiction over the dispute. This Statement of Work is agreed to by Xcel Energy and Muncipality and receipt of the above Down 178,364.00 is herby acknowledged on behalf of Xcel Energy. Print Full Name and Title (if applicable) Address:Address: Phone:Phone: E-mail:E-mail: Estimated Total $ Form 17-7012 Northern States Power Company [Municipality] a Minnesota corporation ("Xcel Energy") Print Full Name and Title Signature Signature of Authorized Representative Xcel Energy Work Order #13063934 Estimated Construction $Estimated Removal $ Date: August 3, 2022 Agenda Item #: VI.K. To:Mayor and City Council Item Type: Other From:Jessica V. Wilson, Water Resources Manager Item Activity: Subject:Approve Access and Construction License Agreement with Nine Mile Creek Watershed District for the Lynmar Basin Stormwater Retrofit Project Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Access and Construction License Agreement with Nine Mile Creek Watershed District for the Lynmar Basin Stormwater Retrofit P roject. INTRODUCTION: This land-use license agreement is part of a collective effort to achieve shared goals for improving water quality in Lake Edina and reducing local flood risk through design, construction and maintenance of the Lynmar Basin Stormwater Retrofit Project. The Cooperative Agreement for the project was approved at the Council's June 21st regular meeting. ATTACHMENTS: Description Lynmar Basin Land Use License Agreement Access and Construction License City of Edina and Nine Mile Creek Watershed District Lynmar Basin Retrofit Project This agreement is made by and between the City of Edina (Edina), a Minnesota municipal corporation, and Nine Mile Creek Watershed District (NMCWD), a watershed district with purposes and powers set forth in Minnesota Statutes chapters 103B and 103D, to grant a land-use license as part of a collective effort to achieve shared goals for improving water quality in Lake Edina and reducing local flood risk through design, construction and maintenance of the Lynmar Basin Stormwater Retrofit Project. Recitals Whereas NMCWD has authority under Minnesota Statutes chapters 103B and 103D to design and implement projects to improve water quality, protect water resources and mitigate risk of and damage from flooding within the Nine Mile Creek watershed; Whereas Edina owns in fee simple Bristol & Mavelle Park, real property in Hennepin County, Minnesota designated in the county records by property identification number 31-028-24-11-0080 (the Park), and holds in trust for public transportation purposes the Bristol Boulevard, Mavelle Drive and Lynmar Lane rights-of-way (collectively, the Rights-of-Way) adjacent to the Park. The Park and Rights-of-Way are shown in Exhibit A, attached hereto and incorporated herein as a term of this license and together are referred to herein as “the Property”; Whereas NMCWD will undertake a construction project to retrofit the existing dry basin in the Park to enhance stormwater-volume reduction and water-quality treatment through increased infiltration, and to reduce flood risk for nearby properties through reconfiguration of the tributary storm sewer to convey runoff to the basin and creation of additional flood storage in the basin (the Project); Whereas the Project will contribute to NMCWD’s realization of the purposes for which it was established by improving water quality in downgradient Lake Edina and reducing flood risk, both of which will also accrue to Edina’s benefit; Whereas in recognition of such mutual benefits to be had from the Project, Edina and NMCWD entered into a cooperative agreement (the Agreement) on June 23, 2022, whereby the parties documented their mutual understanding and expectations with regard to the scope of the Project, agreed to an allocation of costs and responsibilities for the Project, and agreed to the grant by Edina to NMCWD of the property-use rights necessary for its completion that is effected by this license; and Whereas Edina and NMCWD are authorized by Minnesota Statutes section 471.59 to enter into this agreement, providing for access and use of the Property for the Project. NMCWD – Edina 2 Lynmar Basin land-use license License NOW, THEREFORE, in consideration of the foregoing recitals, which are incorporated into and made a part of this license, the parties agree as follows: 1. Grant of License a. Construction. Edina hereby grants and conveys to NMCWD, its contractors, agents, successors and assigns a license over, under, upon and across that portion of the Property shown and labeled “Construction Area” on Exhibit A for purposes of construction of the Project. The license includes the right of ingress and egress and to pass over and through the Construction Area on foot and using motorized equipment for staging of construction and construction, including the right to alter existing grades and perform grading and filling, as well as installation of an outlet pipe to drain the basin in the Park to the existing storm sewer; to disturb, excavate under the Rights-of-Way for purposes of modifying catch basins and associated pipe, installation of high-capacity inlets and reconstruction of storm sewer to route stormwater runoff to the basin in the Park, then restore the streets and associated infrastructure. The rights granted hereby include the right to lay and maintain temporary utilities across or above the Construction Area and to store and stockpile construction materials on the surface of the Construction Area for purposes of construction of the Project. NMCWD, on reasonable notice to Edina, may temporarily restrict or preclude public access to a portion or portions of the Construction Area to ensure safety while construction or maintenance activities are under way. The rights granted by Edina herein will terminate on completion of the Project or on December 31, 2023, whichever is earlier. b. Establishment of Vegetation. Edina hereby grants and conveys to NMCWD, its contractors, agents, successors and assigns a license over, under, upon and across that portion of the Property shown and labeled “Vegetation Area” on Exhibit A for purposes of construction of the Project. The license includes the right of ingress and egress and to pass over and through the Vegetation Area on foot and using motorized equipment to establish and maintain vegetation. The rights granted hereby include the right to lay and maintain temporary utilities across or above the surface of the Vegetation Area for purposes of establishing and maintaining vegetation as part of the Project. NMCWD, on reasonable notice to Edina, may temporarily restrict or preclude public access to a portion or portions of the Vegetation Area to ensure safety or for purposes of the Project. The rights granted by Edina herein will terminate on completion of the Project or on December 31, 2026, whichever is earlier. c. Signage. In accordance with the Agreement, NMCWD and Edina will collaborate on the development of educational and information signage pertinent to the Project, including signage providing notice of the requirements and constraints imposed by this license. Either party to this license may install, maintain, replace or remove signage on the Construction Area related to the Project pursuant to and in accordance with the terms of the Agreement. NMCWD – Edina 3 Lynmar Basin land-use license 2. Restrictions on Use. Edina may use and enjoy and allow the use and enjoyment of the Construction Area and Vegetation for any purposes and engage in or allow others to engage in all activities or uses and enjoy all rights accruing from their ownership of the Property, subject to the following restrictions and the right of NMCWD to use the Property for the purposes herein expressed: a. Construction Area. Edina will not use or permit others to use the Construction Area or permit the construction or alteration of any improvements within the Construction Area during the term of this license in any manner that would damage or interfere with the physical structures or function of the Project. b. Vegetation Area. Edina will not mow or otherwise disturb vegetation, apply fertilizer to, or dispose of yard or other waste in the Vegetation Area or otherwise act or permit actions that damage or interfere with the physical structures or function of the Project during the term of this license. 3. Conduct of the Project; Property Condition. All activity by NMCWD on the Property will be conducted in a safe and workmanlike manner in accordance with the terms of the Agreement. In the event the Property is damaged by the activities of NMCWD or its contractors, agents or assigns pursuant to the exercise of any of NMCWD’s rights under the license, NMCWD will promptly repair or restore the Property to the extent reasonably practicable. On completion of the Project, NMCWD will restore the Construction Area and Vegetation Area to materially the same condition as existed prior to the commencement of construction, except to the degree that the Property is improved by the Project. 4. Insurance. Edina remain solely responsible for maintaining liability and other insurance for its own uses of and authority over the Property. 5. Notice. NMCWD will provide Edina with notice at least 10 days prior to the commencement of construction of the Project. NMCWD may access the Construction Area or Vegetation Ara and undertake work in accordance with and under the terms of the Agreement and this license at any time. Except as otherwise specifically provided herein, all notices required or permitted under this license will be in writing and will be deemed delivered when personally delivered, delivered by documented courier delivery or mailed by United States registered or certified mail, return receipt requested, at the address appearing below or to such other address as each party may designate by a written notice to the other. If to Edina : Director Parks and Recreation City of Edina 7450 Metro Blvd. Edina MN 55439 952-826-0371 NMCWD – Edina 4 Lynmar Basin land-use license If to NMCWD: Administrator 12800 Gerard Drive Eden Prairie, MN 55346 952-835-2078 6. Severability. If any one or more of the provisions of this agreement, or the applicability of any such provision to a specific situation, will be held invalid or unenforceable, such provision will be modified to the extent necessary to make it or its application valid and enforceable, and the validity and enforceability of all other provisions of this agreement and all other applications of any such provision will not be affected thereby. 7. Governing Law. This license will be construed and governed by the laws of the State of Minnesota. 8. No Waiver of Immunity. No provision of this agreement will be interpreted as a waiver of any statutory or common law immunity from or limitation of liability available to Edina or NMCWD, all such immunities and limitations being expressly reserved by Edina and NMCWD. {Signature page follows.} NMCWD – Edina 5 Lynmar Basin land-use license IN WITNESS WHEREOF, the undersigned execute this license, intending to be legally bound. City of Edina, a Minnesota municipal corporation ____________________ Date: ___________________ By _________________ Its _________________ Nine Mile Creek Watershed District __________________________________ Date: ________________ By Randy Anhorn Its Administrator Approved as to form and execution __________________________________ NMCWD counsel NMCWD – Edina 6 Lynmar Basin land-use license EXHIBIT A Site Plan Construction Area & Vegetation Area LYNMAR LANE HAZELTON ROAD MAVELLE DRIVELYNMAR LANE BRISTOL BOULEVARD LYNMAR LANE HAZELTON ROAD MAVELLE DRIVELYNMAR LANE BRISTOL BOULEVARD EXISTING PROPERTY MARKER EXISTING CHAIN LINK FENCE EXISTING PROPERTY BOUNDARY EXISTING RIGHT OF WAY EXISTING PROPERTY MARKER EXISTING CHAIN LINK FENCE EXISTING PROPERTY BOUNDARY EXISTING RIGHT OF WAY REVISION DESCRIPTIONDATEAPP.BYNO.CHK.TO/FOR RELEASED DATE RELEASED Approved Designed Drawn Checked Date Scale DWG. No. BARR PROJECT No. CLIENT PROJECT No. REV. No.Minneapolis, Minnesota Ph: 1-800-632-2277 Corporate Headquarters: DATE LICENSE # SIGNATURE I HEREBY CERTIFY THAT THIS PLAN, SPECIFICATION, OR REPORT WAS PREPARED BY ME OR UNDER MY DIRECTSUPERVISION AND THAT I AM A DULY LICENSED PROFESSIONAL ENGINEER UNDER THE LAWS OF THESTATE OF MINNESOTA. BARR ENGINEERING CO. Project Office: PRINTED NAME AS SHOWN 07/20/2022 MDB3 NINE MILE CREEK WATERSHED DISTRICT EDEN PRAIRIE, MINNESOTA LYNMAR BASIN STORMWATER RETROFIT EDINA, MINNESOTA ACCESS FOR CONSTRUCTION AND MAINTENANCE 23/27-1932.00 FIGURE 17/22/2022 43571 NOT FOR CONSTRUCTION Janna Kieffer CADD USER: Marcy D. Bean FILE: P:\MPLS\23 MN\27\23271932 LYNMAR BASIN STORMWATER RETROF\WORKFILES\AGREEMENT- NM AND EDINA\AGREEMENT_FIGURE 1.DWG PLOT SCALE: 1:2 PLOT DATE: 7/22/2022 10:57 AMCLIENT BID CONSTRUCTION ------- ------- ------- ------- ------- 0 1 2 3 4 5 6 Suite 200 4300 MARKETPOINTE DRIVE Fax: (952) 832-2601 www.barr.com Ph: 1-800-632-2277 MINNEAPOLIS, MN 55435N40200 SCALE IN FEET 1 - PLAN THIS DRAWING ACCURATELY REPRESENTS SITE CONDITIONS, TO SCALE, WITH REPRESENTATION OF EXISTING SITE FEATURES CONSTRUCTION AREA VEGETATION AREA VEGETATION AREA CONSTRUCTION AREA LEGEND Date: August 3, 2022 Agenda Item #: VI.L. To:Mayor and City Council Item Type: Request For Purchase From:Chad A. Millner, P.E., Director of Engineering Item Activity: Subject:Request for Purchase: McCauley Road Private Fence Replacement Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for McCauley Road Private Fence Replacement with All P hase Contracting for $145,612 and approve the use of special assessments with adjacent properties to fund the project. INTRODUCTION: This project will remove and replace an existing wood fence at the end of its service life. The project coordination was requested by a petition from the area property owners. T he 13 property owners have agreed to fund the project but are requesting the use of special assessments. Staff is working to create and get signatures from each property owner on an agreement to pay back the city over 10-years with interest. The agreement will ensure the owners can't object to the assessments levied as part of this project. Staff will seek approval of the special assessment agreements at a later date. ATTACHMENTS: Description Request for Purchase: McCauley Road Private Fence Replacement Staff Report: McCauley Road Private Fence Replacement ENG 22-13 Contract: McCauley Road Private Fence Replacement Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100179 Department: Engineering Buyer: Chad Millner Date: 07/25/2022 Requisition Description: McCauley Road Private Fence Replacement Vendor: All Phase Contracting, Inc. Cost: $145,612.00 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE: QUOTE/BID DESCRIPTION: This project will remove and replace an existing wood fence at the end of its service life. The project coordination was requested by a petition from the area property owners. The 12-14 property owners have agreed to fund the project but are requesting the use of special assessments. Staff is working to create and get signatures from each property owner on an agreement to pay back the city over 10-years with interest. The agreement will ensure the owners can't object to the assessments levied as part of this project. Staff will seek approval of the special assessment agreements at a later date. BUDGET IMPACT: This project is funded by the City and specially assessed back to 12-14 property owners as agreed to over 10- years. 2 ENVIRONMENTAL IMPACT: Minimal changes with a remove and replace fence project. City of Edina • 4801 W. 50th St. • Edina, MN 55424 City of Edina • 4801 W. 50th St. • Edina, MN 55424 August 3, 2022 Mayor and City Council Chad A. Millner, Director of Engineering Petition Response Update: Design and Bid of Private Fence on McCauley Trail Approve a request for purchase for private fence replacement with All Phase Contracting, Inc. for $145,612.00 and Approve the use of special assessments with adjacent properties to fund the project. Project Update: Staff solicited for bids for the various options detailed below. Zero contractors submitted bids on the project. Staff reached out to two of the planholders to better understand why they did not quote on the project. Both firms provided valuable information on how to create quote documents they would respond to. Staff solicited quotes a second time based on the updated plans. Two vendors provided quotes for the work. The low quote firm was All Phase Contracting, Inc. at $115,612.00. At the request of the property owners, the fence will be extended 90-ft to the east. This will increase the cost of the project to $145,612.00. 13 property owners are willing to fund the project split equally between the properties. They are asking the City Council to assess them for the improvements over 10-years. The City Attorney will draft an agreement for each owner that states they agree to pay the assessment and waive their right to an assessment appeal. Staff requests council approve the funding by special assessment and award a contract to All Phase Contracting. Staff will seek approval of the assessments during our normal assessment approval process in October. Information / Background: At their January 19, 2022 regular meeting, City Council received a petition asking council to allow staff to create quote documents and solicit quotes for private fence from Timber Trail to 6537 McCauley Trail. The petition asked for cost estimates for 8-ft, 10-ft, and 12-ft high fences of various materials of wood only, concrete only or a combination. Approximately 27 residents signed the petition. An 8-ft tall private wooden fence currently exists at this location. It is 375-ft long and build by a local contractor approximately 30-years ago. It is at the end of its useful life. It is a private fence and not REPORT / RECOMMENDATION Page 2 maintained by city staff. City staff has offered to remove the fence at no cost to the residents. Any new fence would be private and maintained by adjacent residents. The petition suggested significant interest in replacing the fence and funding the replacement. Staff wants to note this is a private fence and the City does not have an obligation to conduct any work on this project. Since staff has expertise in creating quote documents and soliciting quotes, this project would not be anything new. Staff has capacity to create quote documents and solicit bids if council approves staff working on this private fence. At the February 15, 2022 City Council Meeting, council approved staff time to create quote documents and solicit bids as requested by the petition. Attachments 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 FORM OF AGREEMENT BETWEEN CITY OF EDINA AND CONTRACTOR FOR NON-BID CONTRACT ENG 22-13 THIS AGREEMENT made this 3rd day of August, 2022, by and between the CITY OF EDINA, a Minnesota municipal corporation (“Owner” or “City”) and ALL PHASE CONTRACTING, INC. (“Contractor”). Owner and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents”, all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement B. City of Edina General Contract Conditions C. Specifications prepared by City of Edina D. Drawing (1 sheet), prepared by City of Edina E. Responsible Contractor Verification of Compliance F. Contractor’s Quote In the event of a conflict among the provisions of the Contract Documents, the order in which they are listed above shall control in resolving any such conflicts with Contract Document “A” having the first priority and Contract Document “F” having the last priority. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. CONTRACT PRICE. Owner shall pay Contractor for completion of the Work, in accordance with the Contract $145,612.00 inclusive of taxes, if any. 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by the City Engineer. B. Progress Payments; Retainage. Owner shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractors. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1 ½ percent per month or any part of a month to the subcontractor on any undisputed amount not 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 (attached) required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Final payment will not be made until the Contractor has filed with the Owner a fully and duly executed Affidavit, General Waiver and Indemnity Agreement, in the form attached hereto as Exhibit B and hereby made a part hereof, together with such other and additional evidence as Owner may request, in form and substance satisfactory to the Owner, that all labor, materials and services expended or used in the Work have been paid for in full and that no liens or other claims for such labor, materials or services can be made or claimed against Contractor, Owner or any other person or any property. In case such evidence is not furnished, the Owner may retain out of any amount due said Contractor a sum sufficient, in the reasonable discretion of Owner, but in any event not less than one and one-half times the sum determined by Owner to be necessary, to pay for all labor, material, services or other claims which are then unpaid or which are then believed by Owner, in its reasonable discretion, to be unpaid. Upon final completion of the Work, Owner shall pay the remainder of the Contract Price as recommended by the City Engineer. 5. COMPLETION DATE. The Work must be completed by December 2, 2022. 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local laws and regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and Underground Facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by Owner and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. J. Responsible Contractor. This contract may be terminated by the City at any time upon discovery by the City that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn Stat. § 16C.285, subd. 3. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the Owner the names of the Subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the Owner. 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 (2) The Contractor is responsible to the Owner for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the Owner and any subcontractor. (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. 7. WORKER’S COMPENSATION. The Contractor shall obtain and maintain for the duration of this Contract, statutory Worker’s Compensation Insurance and Employer’s Liability Insurance as required under the laws of the State of Minnesota. 8. COMPREHENSIVE GENERAL LIABILITY. Contractor shall obtain the following minimum insurance coverage and maintain it at all times throughout the life of the Contract, with the City included as an additional name insured on the general liability insurance on a primary and noncontributory basis. The Contractor shall furnish the City a certificate of insurance satisfactory to the City evidencing the required coverage: Bodily Injury: $1,000,000 each occurrence $1,000,000 aggregate products and completed operations Property Damage: $1,000,000 each occurrence $1,000,000 aggregate Contractual Liability (identifying the contract): Bodily Injury: $1,000,000 each occurrence Property Damage: $1,000,000 each occurrence $1,000,000 aggregate Comprehensive Automobile Liability (owned, non-owned, hired): Bodily Injury: $1,000,000 each occurrence $1,000,000 each accident Property Damage: $1,000,000 each occurrence 9. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the quote shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 10. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 11. PERFORMANCE AND PAYMENT BONDS. Performance and payment bonds are not required for the doing of any public work if the contract price is $175,000 or less. On projects of more than $175,000 for the doing of public work a payment bond and a performance bond each in the amount of the contract price must be furnished to the City prior to commencement of work. The form of the bonds must satisfy statutory requirements for such bonds. 12. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. Owner and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any law or regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon Owner and Contractor, who agree that the Contract Documents shall be reformed to replace such stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Software License. If the equipment provided by the Contractor pursuant to this Contract contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 F. Patented devices, materials and processes. If the Contract requires, or the Contractor desires, the use of any design, device, material or process covered by letters, patent or copyright, trademark or trade name, the Contractor shall provide for such use by suitable legal agreement with the patentee or owner and a copy of said agreement shall be filed with the Owner. If no such agreement is made or filed as noted, the Contractor shall indemnify and hold harmless the Owner from any and all claims for infringement by reason of the use of any such patented designed, device, material or process, or any trademark or trade name or copyright in connection with the Project agreed to be performed under the Contract, and shall indemnify and defend the Owner for any costs, liability, expenses and attorney's fees that result from any such infringement. G. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Contract without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. H. Waiver. In the particular event that either party shall at any time or times waive any breach of this Contract by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Contract by either party, whether of the same or any other covenant, condition or obligation. I. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Contract. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. J. Severability. If any provision, term or condition of this Contract is found to be or become unenforceable or invalid, it shall not effect the remaining provisions, terms and conditions of this Contract, unless such invalid or unenforceable provision, term or condition renders this Contract impossible to perform. Such remaining terms and conditions of the Contract shall continue in full force and effect and shall continue to operate as the parties’ entire contract. K. Entire Agreement. This Contract represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. L. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of- way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. 140400v01 ENG 22-13 RNK:08/06/2010 Engineering 1/2015 M. If the work is delayed or the sequencing of work is altered because of the action or inaction of the Owner, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ___________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.M. To:Mayor and City Council Item Type: Request For Purchase From:Jon Darsow, Facilities Supervisor Item Activity: Subject:Request for Purchase: Braemar Parking Lot Resurfacing and Lighting Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Request for Purchase for Braemar Arena P arking Lot Resurfacing and Lighting Improvements with FPI Paving Contractors Inc. for $664,926. INTRODUCTION: The existing north and west lots at Braemar Ice Arena have reached the end of their useful life and are in need of replacement. This project will install new bituminous pavement, updated pavement markings to improve traffic flow, eight LED light poles to improve visibility, an EV charging station with capabilities of adding another station and security camera networks. ATTACHMENTS: Description Request for Purchase: Braemar Parking Lot Resurfacing and Lighting Contract FC 22-103 Braemar Parking Lot Resurfacing and Lighting Request for Purchase Requisition Number 1 CITY OF EDINA 4801 W 50th St., Edina, MN 55424 www.EdinaMN.gov | 952-927-8861 12100184 Department: Engineering Buyer: Jon Darsow Date: 07/26/2022 Requisition Description: Braemar Parking Lot Resurfacing and Lighting Vendor: FPI Paving Contractors, Inc. Cost: $664,926.50 REPLACEMENT or NEW:REPLACEM - REPLACEMENT PURCHASE SOURCE: QUOTE/BID DESCRIPTION: The existing North and West lots at Braemar Ice Arena have reached the end of their useful life and are in need of replacement. This project will install new bituminous pavement, updated pavement markings to improve traffic flow, eight LED light poles to improve visibility, an EV charging station with capabilities of adding another station and security camera networks. BUDGET IMPACT: This project is funded from budget surplus dedicated to facility related replacements. 2 ENVIRONMENTAL IMPACT: The lighting system will utilize LED lights and the EV charging station is the first at the arena. COMMUNITY IMPACT: This project will install new bituminous pavement, updated pavement markings to improve traffic flow, eight LED light poles to improve visibility, an EV charging station with capabilities of adding another station and security camera networks. 1 1/2015 CONTRACT NO. FC 22-103 THIS AGREEMENT made this 3rd day of August, 2022, by and between the CITY OF EDINA, a Minnesota municipal corporation (“City”) and FPI Paving Contractors, Inc., 3230 Rice Street, St Paul, MN 55126 (“Contractor”). City and Contractor, in consideration of the mutual covenants set forth herein, agree as follows: 1. CONTRACT DOCUMENTS. The following documents shall be referred to as the “Contract Documents,” all of which shall be taken together as a whole as the contract between the parties as if they were set verbatim and in full herein: A. This Agreement. B. Instructions to Bidders. C. City of Edina General Contract Conditions. D. Addenda number 1. E. Specifications prepared by William J. Bauer, P.E., dated July 1, 2022. F. Plan sheets numbered 1 to 11. G. Performance Bond. H. Payment Bond. I. Responsible Contractor Verification of Compliance J. Contractor’s Bid dated July 26, 2022. The Contract Documents are to be read and interpreted as a whole. The intent of the Contract Documents is to include all items necessary for the proper execution and completion of the Work and to require Contractor to provide the highest quality and greatest quantity consistent with the Contract Documents. If there are inconsistencies within or among part of the Contract Documents or between the Contract Documents and applicable standards, codes or ordinances, the Contractor shall provide the better quality or greater quantity of Work or comply with the more stringent requirements. 1.1 Before ordering any materials or doing any Work, the Contractor shall verify measurements at the Project site and shall be responsible for the correctness of such measurements. No extra charges or compensation will be allowed on account of differences between actual dimensions and the dimensions indicated on the Drawings. Any difference that may be found shall be submitted to the City for resolution before proceeding with the Work. 1.2 If a minor change in the Work is necessary due to actual field conditions, the Contractor shall submit detailed drawings of such departure to the City for approval before making the change. The City shall not be required to make any adjustment to either the Contract Sum or Contract Time because of any failure by the Contractor to comply with the requirements of this paragraph. Actual or alleged conflicts or inconsistencies between the Plans and Specifications or other Contract Documents shall be brought to the City’s attention in writing, prior to performing the affected Work. The City’s directions shall be followed by the Contractor. 2. OBLIGATIONS OF THE CONTRACTOR. The Contractor shall provide the goods, services, and perform the work in accordance with the Contract Documents. 3. OBLIGATIONS OF THE CITY. The City agrees to pay and the Contractor agrees to receive and accept payment in accordance with the Contractor’s bid $664,926.50. 2 1/2015 4. PAYMENT PROCEDURES. A. Contractor shall submit Applications for Payment. Applications for Payment will be processed by City as provided in the General Conditions. B. Progress Payments; Retainage. City shall make 95% progress payments on account of the Contract Price on the basis of Contractor’s Applications for Payment during performance of the Work. C. Payments to Subcontractor. (1) Prompt Payment to Subcontractors. Pursuant to Minn. Stat. § 471.25, Subd. 4a, the Contractor must pay any subcontractor within ten (10) days of the Contractor’s receipt of payment from the City for undisputed services provided by the subcontractor. The Contractor must pay interest of 1½ percent per month or any part of a month to the subcontractor on any undisputed amount not paid on time to the subcontractor. The minimum monthly interest penalty payment for an unpaid balance of $100.00 or more is $10.00. For an unpaid balance of less than $100.00, the Contractor shall pay the actual penalty due to the subcontractor. (2) Form IC-134 required from general contractor. Minn. Stat. § 290.92 requires that the City of Edina obtain a Withholding Affidavit for Contractors, Form IC-134, before making final payments to Contractors. This form needs to be submitted by the Contractor to the Minnesota Department of Revenue for approval. The form is used to receive certification from the state that the vendor has complied with the requirement to withhold and remit state withholding taxes for employee salaries paid. D. Final Payment. Upon final completion of the Work, City shall pay the remainder of the Contract Price as recommended by City. 5. COMPLETION DATE. The Work must be completed and ready for final payment by June 2, 2023. 6. CONTRACTOR’S REPRESENTATIONS. A. Contractor has examined and carefully studied the Contract Documents and other related data identified in the Contract Documents. B. Contractor has visited the Site and become familiar with and is satisfied as to the general, local, and Site conditions that may affect cost, progress, and performance of the Work. C. Contractor is familiar with and is satisfied as to all federal, state, and local Laws and Regulations that may affect cost, progress, and performance of the Work. D. Contractor has carefully studied all: (1) reports of explorations and tests of subsurface conditions at or contiguous to the Site and all drawings of physical conditions in or relating to existing surface or subsurface structures at or contiguous to the Site (except Underground Facilities) which have been identified in the General Conditions; and (2) reports and drawings of a Hazardous Environmental Condition, if any, at the Site. E. Contractor has obtained and carefully studied (or assumes responsibility for doing so) all additional or supplementary examinations, investigations, explorations, tests, studies, and data concerning conditions (surface, subsurface, and underground facilities) at or contiguous to the Site which may affect cost, progress, or performance of the Work or which relate to any aspect of the means, methods, techniques, 3 1/2015 sequences, and procedures of construction to be employed by Contractor, including any specific means, methods, techniques, sequences, and procedures of construction expressly required by the Bidding Documents, and safety precautions and programs incident thereto. F. Contractor does not consider that any further examinations, investigations, explorations, tests, studies, or data are necessary for the performance of the Work at the Contract Price, within the Contract Times, and in accordance with the other terms and conditions of the Contract Documents. G. Contractor is aware of the general nature of work to be performed by City and others at the Site that relates to the Work as indicated in the Contract Documents. H. Contractor has correlated the information known to Contractor, information and observations obtained from visits to the Site, reports and drawings identified in the Contract Documents, and all additional examinations, investigations, explorations, tests, studies, and data with the Contract Documents. I. Contractor has given City written notice of all conflicts, errors, ambiguities, or discrepancies that Contractor has discovered in the Contract Documents, and the written resolution thereof by City is acceptable to Contractor. J. The Contract Documents are generally sufficient to indicate and convey understanding of all terms and conditions for performance and furnishing of the Work. K. Subcontracts: (1) Unless otherwise specified in the Contract Documents, the Contractor shall, upon receipt of the executed Contract Documents, submit in writing to the City the names of the subcontractors proposed for the work. Subcontractors may not be changed except at the request or with the consent of the City. (2) The Contractor is responsible to the City for the acts and omissions of the Contractor's subcontractors, and of their direct and indirect employees, to the same extent as the Contractor is responsible for the acts and omissions of the Contractor's employees. (3) The Contract Documents shall not be construed as creating any contractual relation between the City and any subcontractor. (4) The Contractor shall bind every subcontractor by the terms of the Contract Documents. 7. WARRANTY. The Contractor guarantees that all new equipment warranties as specified within the bid shall be in full force and transferred to the City upon payment by the City. The Contractor shall be held responsible for any and all defects in workmanship, materials, and equipment which may develop in any part of the contracted service, and upon proper notification by the City shall immediately replace, without cost to the City, any such faulty part or parts and damage done by reason of the same in accordance with the bid specifications. 8. INDEMNITY. The Contractor agrees to indemnify and hold the City harmless from any claim made by third parties as a result of the services performed by it. In addition, the Contractor shall reimburse the City for any cost of reasonable attorney’s fees it may incur as a result of any such claims. 9. MISCELLANEOUS. A. Terms used in this Agreement have the meanings stated in the General Conditions. B. City and Contractor each binds itself, its partners, successors, assigns and legal representatives to the other party hereto, its partners, successors, assigns and legal representatives in respect to all covenants, agreements, and obligations contained in the Contract Documents. C. Any provision or part of the Contract Documents held to be void or unenforceable under any Law or Regulation shall be deemed stricken, and all remaining provisions shall continue to be valid and binding upon City and Contractor, who agree that the Contract Documents shall be reformed to replace such 4 1/2015 stricken provision or part thereof with a valid and enforceable provision that comes as close as possible to expressing the intention of the stricken provisions. D. Data Practices/Records. (1) All data created, collected, received, maintained or disseminated for any purpose in the course of this Contract is governed by the Minnesota Government Data Practices Act, Minn. Stat. Ch. 13, any other applicable state statute, or any state rules adopted to implement the act, as well as federal regulations on data privacy. (2) All books, records, documents and accounting procedures and practices to the Contractor and its subcontractors, if any, relative to this Contract are subject to examination by the City. E. Copyright/Patent. Contractor shall defend actions or claims charging infringement of any copyright or patent by reason of the use or adoption of any designs, drawings or specifications supplied by it, and it shall hold harmless the City from loss or damage resulting there from. If the equipment provided by the Contractor pursuant to this Agreement contains software, including that which the manufacturer may have embedded into the hardware as an integral part of the equipment, the Contractor shall pay all software licensing fees. The Contractor shall also pay for all software updating fees for a period of one year following cutover. The Contractor shall have no obligation to pay for such fees thereafter. Nothing in the software license or licensing agreement shall obligate the City to pay any additional fees as a condition for continuing to use the software. F. Assignment. Neither party may assign, sublet, or transfer any interest or obligation in this Agreement without the prior written consent of the other party, and then only upon such terms and conditions as both parties may agree to and set forth in writing. G. Waiver. In the particular event that either party shall at any time or times waive any breach of this Agreement by the other, such waiver shall not constitute a waiver of any other or any succeeding breach of this Agreement by either party, whether of the same or any other covenant, condition or obligation. H. Governing Law/Venue. The laws of the State of Minnesota govern the interpretation of this Agreement. In the event of litigation, the exclusive venue shall be in the District Court of the State of Minnesota for Hennepin County. I. Severability. If any provision, term or condition of this Agreement is found to be or becomes unenforceable or invalid, it shall not affect the remaining provisions, terms and conditions of this Agreement, unless such invalid or unenforceable provision, term or condition renders this Agreement impossible to perform. Such remaining terms and conditions of the Agreement shall continue in full force and effect and shall continue to operate as the parties’ entire agreement. J. Entire Agreement. This Agreement represents the entire agreement of the parties and is a final, complete and all inclusive statement of the terms thereof, and supersedes and terminates any prior agreement(s), understandings or written or verbal representations made between the parties with respect thereto. K. Permits and Licenses; Rights-of-Way and Easements. The Contractor shall procure all permits and licenses, pay all charges and fees therefore, and give all notices necessary and incidental to the construction and completion of the Project. The City will obtain all necessary rights-of-way and easements. The Contractor shall not be entitled to any additional compensation for any construction delay resulting from the City’s not timely obtaining rights-of-way or easements. L. If the work is delayed or the sequencing of work is altered because of the action or inaction of the City, the Contractor shall be allowed a time extension to complete the work but shall not be entitled to any other compensation. 5 1/2015 M. Responsible Contractor. This contract may be terminated by the City at any time upon discovery by the City that the prime contractor or subcontractor has submitted a false statement under oath verifying compliance with any of the minimum criteria set forth in Minn Stat. § 16C.285, subd. 3. CITY OF EDINA CONTRACTOR BY: ____________________________ BY: ____________________________ Its Mayor Its AND ___________________________ AND ___________________________ Its City Manager Its Date: August 3, 2022 Agenda Item #: VI.N. To:Mayor and City Council Item Type: Report / Recommendation From:Nick Bauler, Traffic Safety Coordinator Item Activity: Subject:Approve Traffic Safety Report of June 28, 2022 Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve the Traffic Safety Report of June 28, 2022. INTRODUCTION: The Transportation Commission reviewed the report at their July 21 regular meeting; comments are included in the attached staff report. ATTACHMENTS: Description Traffic Safety Report of June 28, 2022 August 3, 2022 Mayor and City Council Nick Bauler, Traffic Safety Coordinator Traffic Safety Report of June 28, 2022 Information / Background: The Traffic Safety Committee (TSC) review of traffic safety matters occurred on June 28. The Traffic Safety Coordinator, City Engineer, Streets Public Service Worker, Public Works Director, Police Sergeant and Assistant City Planner were in attendance for this meeting. The Transportation Planner was not able to attend but was informed of the decisions and had no objections to the recommendations. On each of the items, persons involved have been contacted and the staff recommendation has been discussed with them. They were informed that if they disagree with the recommendation or have additional facts to present, they can submit correspondence to the Transportation Commission and/or to City Council prior to the August 3 regular meeting. Section A: Items on which the Traffic Safety Committee recommends action A1. Request for crosswalk improvements at Valley View and Sally Ln • Resident concerned about crosswalk with no signage. • Valley View was reconstructed in 2015. • Intersection has marked crosswalk with in- street sign. • No pedestrian ramp on north end. • Valley View ADT is 2,560. • Valley View has bike lanes and a sidewalk on south side. • Observed 93 pedestrian and 7 bike crosses were observed in May 2022. Staff recommends installing roadside signs to align with the City crosswalk policy. Valley View Rd at Sally Ln STAFF REPORT Page 2 A2. Request for additional parking restriction sign on Wooddale Avenue south of Valley View Road • Resident concerned with drivers parking illegally on east side of Wooddale. • Three restriction signs north of Garrison Ln, northern two are approx. 260’ apart. • Parking issues exacerbated during project at 4425 Valley View. Staff recommends installing a sign to clarify current restrictions. A3. Request for street name sign for Arbour Ln at Jeff Pl intersection • Arbour Ln is located between Tracy Ave, Arbour Ave and Jeff. • Resident is having issues with people finding their home, particularly coming from Jeff. • Where Arbour Ave & Ln intersect with Jeff Pl, no sign shows Arbour Ln. Staff recommends updating the street name signage to include Arbour Ln with directional arrows. A4. Review guardrail specifications at W 78th St eastbound guardrail west of West Bush Lake Rd • Eastbound direction includes guardrail along curve. • One crash west of W Bush Lake Rd. • Vehicle traveling west on 78th was struck by a SB vehicle exiting 7700 78th • 2013 AADT was 7,900. • Guardrail is damaged regularly from snowplow operations. • Narrow spacers would prevent continuous damage from plows. • MnDOT structural engineers advised that the size and width of the spacers could be reduced based on historical crash frequency and severity without impacting safety of the traveling public. Staff recommends installing smaller spacers on the guardrail to reduce the likelihood of repetitive snowplow damage. Wooddale Ave and Valley View Rd Arbour Ln W 78th St Guardrail STAFF REPORT Page 3 A5. Request for parking restrictions adjacent to 5313 W 56th St • Many residents have safety concerns when vehicles parked on the south side of W 56th St east of Dale Ave. • Melody Lake neighborhood was reconstructed in 2021. • 5313 W 56th is a group home with frequent workers and visitors needing on-street parking. • W 56th between Hansen Rd and Dale is 21’ wide, tapers to 24’ east of Dale. • Living Streets design guidelines recommend no on-street parking on streets less than 24’ wide. • W 56th is measured 24’ wide approximately 19’ west of the driveway at 5313 W 56th. • Parking is restricted on the north side of W 56th. Staff recommends installing a parking restriction sign with a placard stating “From Corner To Here” approximately 19’ west of the driveway of 5313 W 56th. Section B: Items on which the Traffic Safety Committee recommends no action B1. Review traffic study along northbound Normandale Rd between W 70th and W 66th St • Previous complaints of high speeds. • New lane layout includes travel lane, buffer, bike lane and parking bay (left to right). • Current complaints during winter months of vehicles driving in two lanes when road is snow-covered. • Resident had a mailbox hit and wrecked. • Traffic study in August 2019. i. ADT 2,138 ii. 85% Speed 35.6 • Traffic study conducted in May 2022. i. ADT 1,733 ii. 85% speed 37.1 • Resident is requesting bump-outs at Payton Ct and W 69th to further distinguish the parking lane. Staff recommends no changes. Future work along Normandale can offer options for added traffic calming treatments. Normandale Rd between W 66th and W 70th St W 56th St STAFF REPORT Page 4 B2. Request for parking restriction adjacent to bus stop on W 74th St, east of Bush Lake Rd • Bus driver reported difficulties for users accessing bus when vehicles are parked on W 74th. • Parking restriction adjacent to 7401 Bush Lake Rd was removed in 2020. • 2011 W 74th ADT 3420 • Parking demand increased in past 3 years – Wooden Hill Brewery, other businesses. • Sidewalk installed in 2020. Staff recommends not adding parking restrictions with increasing demand for on-street parking in the area. A discussion with Metro Transit will take place regarding options for improvement. Section D: Other traffic safety items handled D1. Many requests made for speed enforcement along Valley View Rd, W 66th St, Cahill Rd, W 70th St, Dewey Hill Rd, Schaefer Rd. These requests were submitted to EPD for enforcement. D2. A resident was concerned for a sidewalk blocked with signs on Vernon Ave west of Tracy Ave. The sidewalk was closed due to a utility project with a detour onto the eastbound shoulder on Vernon. The resident was informed to follow the detour. D3. A resident was concerned for the safety of neighborhood children playing in the street near the intersection of Zenith Ave and W 59th St. The resident was recommended to speak to their neighbors recommending refraining from playing in the street and to use caution if doing so. D4. A resident was concerned about a missing parking restriction sign on Alden Dr. The sign was replaced by the Public Works Department. D5. A commuter had concerns of using round-abouts on W 70th as a bicyclist. The user was informed bicyclists have the right-of-way like any other vehicle when entering round-abouts. D6. A resident was requesting temporary parking restrictions for pickup and drop off traffic on Richmond Dr for Our Lady of Grace students. No signage is warranted as Richmond can accommodate vehicles parking on both sides of the street with vehicles able to pass thru. D7. A resident requested speed limit signs on W 40th St citing fast traffic. A traffic study found the 85% speed was 27 mph. No action is recommended. D8. A resident requested to relocate a stop sign on Indian Hills Rd at Indian Hills Pass citing eastbound vehicles fail to stop as it’s in a poor location. Due to the intersection layout, the sign should remain in place with no evidence of vehicles failing to follow it at the current location. D9. A request was made for added stop signs or speed humps along the driveway of 3250 W 66th St connecting between York Ave citing vehicles travel at high speeds or even cut thru onto York. The requester was informed to contact the property management as the driveway is private property and outside of City jurisdiction. February 2022 November 2019 STAFF REPORT Page 5 D10. A request was made to improve damaged curb on John St from City plows. Request was sent to Public Works. D11. A resident was concerned with the visibility of a stop sign for eastbound traffic on Tower St at St. Johns. The City Forester inspected the sign and provided the resident a notice to trim vegetation covering the sign. D12. A resident requested a duck crossing sign on W 64th St between York Ave and Xerxes Ave. Edina does not utilize such signs as they provide no change in driver behavior. D13. A resident requested updating the pedestrian signal when crossing France Ave at Gallagher Dr. This was sent to Hennepin County staff as the County owns and operates this signal. Date: August 3, 2022 Agenda Item #: VI.O. To:Mayor and City Council Item Type: Report / Recommendation From:Todd Milburn, Chief of Police Item Activity: Subject:Resolution No. 2022-66: Approving the Fencing Consortium Joint Powers Agreement Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Adopt Resolution No. 2022-66 approving the fencing consortium joint powers agreement. INTRODUCTION: Based on the experience with civil unrest in Minneapolis and Brooklyn Center, the critical role that anti-scale fencing can serve for de-escalation and establishing a space for lawful protests became apparent. A significant number of public agency professionals joined together to form a Fence Working Group. The Fence Working Group’s efforts have led to the formation of a Fencing Consortium. The Fencing Consortium, made up of local government agencies, will jointly contract with a fencing vendor for the availability, storage, maintenance, and transportation of anti-scale fencing. ATTACHMENTS: Description Resolution No. 2022-66: Approving the Fencing Consortium Joint Powers Agreement Edina Mutual Aid Memo Fence Consortium Joint Powers Agreement RESOLUTION NO. 2022-66 APPROVING THE FENCING CONSORTIUM JOINT POWERS AGREEMENT WHEREAS, the governmental units in the state have experienced an increase in incidences of civil unrest with violent and destructive actors who pose a threat to the public, public personnel, buildings, and critical infrastructure; and WHEREAS, the First Amendment of the United States Constitution protects the freedom of speech, the press, and the right of the people peaceably to assemble, and to petition the government for a redress of grievances; and WHEREAS, recent experience has shown that the use of anti-scale fencing has greatly de- escalated tension between law enforcement and protesters; and WHEREAS, by de-escalating the tension, the anti-scale fencing helps to reduce the trauma on the community, improve the safety for all, minimize the impact on neighboring properties, and reduce the community resources that have to be committed to such events; and WHEREAS, governmental units have recognized the need to have ready access to anti-scalable fencing as a tool for de-escalation and community safety while protecting against violent and destructive actors; and WHEREAS, the best means for a governmental unit to access such fencing in a timely and cost- effective manner is to work cooperatively with other governmental units; and WHEREAS, the Fencing Consortium Joint Powers Agreement (“Fencing JPA”), which is incorporated herein by reference, establishes a joint board to obtain and make available to members anti- scalable fencing in response to critical incidences, sets out the powers of the joint board, requires members to pay their share of the fencing costs and operational costs of the Fencing Consortium, requires members to provide staffing to assemble and disassemble the fencing as part of the Public Works Mutual Aid Pact, and otherwise provides for the operation of the Fencing Consortium as a joint powers entity; and WHEREAS, the governmental unit is a member of the Public Works Mutual Aid Pact and is otherwise eligible to adopt the Fencing JPA; and WHEREAS, it is in the best interests of the community to become a member and participate in the Fencing Consortium. NOW, THEREFORE, BE IS RESOLVED, by the City Council of Edina, Minnesota as follows: 1. The Fencing JPA is hereby approved and adopted. 2. The City Manager is authorized and directed to make nominations and to cast votes on persons to be elected to the Fencing Consortium Board of Directors. 3. Staff are authorized and directed to do each of the following: a. Submit a fully executed copy of this Resolution as directed in the Fencing JPA to indicate membership in the Fencing Consortium; b. Designate a primary and secondary point of contact for the Fencing Consortium for administrative purposes. c. Coordinate with the other Fencing Consortium members and the Board on the selection of staff from the public works department to serve on the fencing deployment team; and d. To take such other actions as may be needed to carry out the intent of this Resolution and as may be required under the terms of the Fencing JPA. Passed and adopted by the City Council on this 3rd day of August, 2022. Attest: Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA) COUNTY OF HENNEPIN) SS CITY OF EDINA ) CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached and foregoing Resolution was duly adopted by the Edina City Council at its Regular Meeting of August 3, 2022, and as recorded in the Minutes of said Regular Meeting. WITNESS my hand and seal of said City this _________ day of ___________________, 2022. City Clerk City of Edina • 4801 W. 50th St. • Edina, MN 55424 Edina Police Department Phone 952-826-1610 • Fax 952-826-1607 • www.EdinaMN.gov Date: May 9, 2022 To: Mayor and City Council From: Subject: Chief Todd Milburn Fence Consortium Joint Powers Agreement Background In the spring of 2021, a significant number of public agency professionals (with police, fire, public works, and emergency management backgrounds) joined together to form a Fence Working Group to explore the identified challenges and develop a collective path forward. Based on the experience with civil unrest in Minneapolis and Brooklyn Center, the critical role that anti-scale fencing can serve for de-escalation and establishing a space for lawful protests became apparent. That said, it was also found that obtaining anti- scale fencing is a significant challenge due to a number of factors, as well as being very expensive. To respond to this identified need, a Fence Working Group was established. The Fence Working Group’s efforts have led to the formation of a Fencing Consortium. The Fencing Consortium is made up of local government agencies (members) that will; jointly contract with a fencing vendor for the availability, storage, maintenance, and transportation of anti-scale fencing (including vehicle gates and pedestrian doors). The Consortium will have, at a minimum, enough fencing for the largest police department building in the Consortium. However, the Consortium has the flexibility to increase the amount of fencing, gates, and doors as additional local governments join the Consortium. The intent of the Fencing Consortium is to provide anti-scale fencing within hours, not days, around potentially impacted government building(s) in response to a critical incident. The goal of the anti-scale fencing is to de-escalate the potential tensions and try to reduce/eliminate the non-tangibles associated with civil unrest such as: 1) Provide physical separation between law enforcement and protestors a. Promotes improved mental health environment for all (reduce PTSD) b. Pre-plan and standardize perimeter layout 2) Reduce the need for crowd control measures to be used a. Improved safety for all b. Minimize potential impact on adjacent properties c. Crowd control measures are seen as escalating d. Another tool for law enforcement facilitating peaceful protests Page 2 City of Edina • 4801 W. 50th St. • Edina, MN 55424 3) Create a space for protesting a. Not seen as officers vs. protestors, but protestors just protesting (including optics) b. Supports efforts to coordinate/communicate with specific protest groups and organizers ahead of time c. Improved distinction between legal protestors and violent and destructive actors d. Officers in riot gear and with crowd control measures are more likely to be able to remain out of sight of legal protestors 4) Reduce resource demands committed to one location a. Local law enforcement agencies are too small to handle large-scale civil disturbance b. Potentially need fewer officers for security at the site c. Free up more resources to continue to respond to calls for service in impacted community d. Takes into consideration that protests may be protracted event The purpose and structure of the Fence Consortium is to provide experienced leadership for fence deployment operations across multiple jurisdictions in a unified command structure and coordinate during the deployment of anti-scale fencing. This includes considering and planning for operational logistics and tactical planning associated with fence deployment. The Fence Consortium itself is a multi- agency, pre-planned, coordinated resource management system to continue efforts to minimize multiple local and state agencies from being over-extended. Fence deployment team One of the biggest costs and factors for the deployment of any fence is the labor, equipment, and scheduling of staffing to setup the fence. Because of this the Working Group determined that the best way to meet these challenges is to use the existing Statewide Public Works Mutual Aid Pact to provide the labor and equipment needed to deploy the fence. Just like police and fire use existing mutual aid agreements during civil unrest, public works would do the same. One key reason for this is that the JPA can leverage these other existing mutual aid agreements when it comes to labor considerations. Each Consortium member would need to provide between 1 and 3 people who would be assigned to the Fence Deployment Team. This team would train 3 times a year (2 times in person) so that when the call to deploy the fence was made, everyone would be familiar with what needed to be done and it could be done as efficiently as possible. Each Consortium member would cover the costs, including if there was a deployment (likely overtime), of their staff on the Fence Deployment Team. Considerations will be made for really small public works departments (just a few members) or agencies with no public works staff. State funding request The Fence Consortium has requested $5 million dollars from the State of Minnesota for the purchase of anti-scale fencing and associated vehicle gates and pedestrian doors. If obtained, the State funding for the purchase of anti-scale fencing for the Fencing Consortium will significantly reduce the on-going cost each Consortium member will pay for the storage, maintenance, and transportation of the anti-scale fence. This Page 3 City of Edina • 4801 W. 50th St. • Edina, MN 55424 reduction in cost will improve equity in accessibility to this de-escalation and safety tool for communities across not only the Seven County Metro area, but also the state as a whole. Prerequisites Any agency participating in the Fence Consortium must be a member of the Statewide Public Works Mutual Aid Pact. Police and fire agency resources must be members of relevant mutual aid agreements. Project cost Each member agency’s cost is pro-rated based on the footage of fencing needed for their location. The annual estimated cost for the City of Edina is $7,181. Attachment Fencing Consortium Joint Powers Agreement Recommended action Motion authorizing the resolution adopting the Fencing Consortium Joint Powers Agreement 1 CR225-476-758705.v8 FENCING CONSORTIUM JOINT POWERS AGREEMENT THIS FENCING CONSORTIUM JOINT POWERS AGREEMENT (“Agreement”) is made and entered into by and among the Governmental Units identified in the attached Exhibit A (each a “Member” or collectively the “Members”). RECITALS A. The civil unrest and resulting negative impacts on mental health, damage to buildings, and a reduction in overall safety experienced in the Seven County Metropolitan Area in recent years has given rise to a need for communities to have ready access to anti- scalable fencing. The anti-scale fencing can be set up to protect public buildings, critical infrastructure, and other key locations to de-escalate tensions between law enforcement and protestors as well as reduce the need to rely on crowd control measures to protect such locations from violent and destructive actors. B. Appropriate fencing to serve this purpose is produced by few vendors, currently all of which are located outside of the state. C. This type of fencing is expensive and the delays associated with attempting to identify and secure the delivery of fencing during the response to a critical incident may result in unnecessary risks to personnel and public property. D. By pooling resources and working cooperatively, communities can access high quality fencing, trained personnel, and related resources to assemble it in as efficient manner as possible to support de-escalation measures with protestors and protect facilities from violent and destructive actors. AGREEMENT In consideration of the mutual agreements and understandings, and intending to be legally bound, the Members hereby agree as follows: ARTICLE I DEFINITIONS AND PURPOSE 1.1. Definition of Terms. For the purposes of this Agreement, the following terms shall have the meaning given them in this section. (a) Additional Member. “Additional Member” means a Governmental Unit that submits a Membership Resolution after the Effective Date and that the Board votes to accept as a Member of the Fencing Consortium. (b) Agreement. “Agreement” means this Fencing Consortium Joint Powers Agreement. 2 CR225-476-758705.v8 (c) Board. “Board” means the Fencing Consortium Joint Board established by this Agreement. (d) Call Out. “Call Out” means a request by a Requesting Member to the Board requesting the deployment of the Fencing. (e) Critical Incident. “Critical Incident” means an event or occurrence that occurs within a Governmental Unit that is reasonably anticipated to result in, or that does result in, civil unrest focused against one or more public buildings, infrastructure, or other critical site with the Governmental Unit. (f) Deployment Site. “Deployment Site” means the specific location at which the Fence is to be assembled. (g) Deployment Team. “Deployment Team” means the public works personnel or others assigned by each Member who are responsible for responding to requests by Members to assemble and disassemble the Fencing at a Member’s Deployment Site in accordance with its Fencing Preplan. (h) Deployment Team Manager. “Deployment Team Manager” is the member of the Deployment Team designated as supervisor and who has operational control over the deployment and demobilization of the Fencing. (i) Effective Date. “Effective Date” means the date this Agreement goes into effect and the date by which Original Members must adopt the Membership Resolution. The Effective Date is September 2, 2022. (j) Extended Membership Area. “Extended Membership Area” means the area established by the Board outside of the Seven County Metropolitan Area in which Governmental Units are eligible to request membership in the Fencing Consortium. (k) Fencing. “Fencing” means the non-scalable, portable, free-standing fence secured by the Board and made available to Members under this Agreement. (l) Fencing Preplan. “Fencing Preplan” means a plan developed by a Governmental Unit showing the general location and length of the Fencing needed and the type and location of gates within the Fencing. (m) Governmental Unit. “Governmental Unit” means a local government or other political subdivision of the State that is authorized under Minnesota Statutes, section 471.59 to enter into a joint powers agreement. The term also includes state agencies and joint powers entities that own a public building. (n) Lease. “Lease” means the lease agreement between the Board and the Vendor to secure the Fencing for the Fencing Consortium and that sets out the terms for the 3 CR225-476-758705.v8 storge, delivery, and maintenance of the Fencing. The Lease may also establish the use charge the Requesting Member is required to pay the Vendor for the actual use of the Fencing. (o) Member. “Member” means an Original Member or an Additional Member. The term is used generally in this Agreement to refer to an individual current member Governmental Unit or, in its plural form, to all current member Governmental Units. A Governmental Unit must remain in good standing under this Agreement to remain a Member of the Fencing Consortium. (p) Member Assessment. “Member Assessment” means the amount determined annually by the Board to pay the costs of the Fencing Consortium and which is invoiced to each Member. (q) Membership Resolution. “Membership Resolution” means the resolution form a Governmental Unit adopts to join the Fencing Consortium. Any resolution that is not substantively the same in all respects as the form resolution developed for membership shall not constitute a Membership Resolution. (r) Notification System. “Notification System” means the communications or alert system, or systems, selected by the Board to issue a Call Out for the deployment of the Deployment Team and Fencing to a Requesting Member’s Governmental Unit. (s) Original Member. “Original Member” means a Governmental Unit that completed all requirements to enter into this Agreement prior to the Effective Date. (t) Public Works Mutual Aid Pact. “Public Works Mutual Aid Pact” means the Public Works Joint Powers Mutual Aid Agreement, which was originally effective as of July 1, 2018 and is incorporated herein by reference. (u) Requesting Member. “Requesting Member” means a Member who makes a request to the Board for the deployment of the Fencing in its Governmental Unit. (v) Seven County Metropolitan Area. “Seven County Metropolitan Area” means the counties of Anoka, Carver, Dakota, Hennepin, Ramsey, Scott, and Washington. (w) Staging Area. “Staging Area” means the location identified for the Deployment Team to gather at in response to a Call Out before convoying to the Deployment Site. (x) Surcharge. “Surcharge” means the amount an Additional Member is required to pay to join the Fencing Consortium as determined by the Board. The Surcharge is in addition to the amount the Additional Member is required to pay based on the length of its Fencing needs as shown in its Fencing Preplan. The Surcharge 4 CR225-476-758705.v8 includes the amount the Member is to pay for the Member Assessment for the year in which the Governmental Unit becomes a Member and any buy-in costs as determined by the Board. (y) Vendor. “Vendor” means the fencing company selected to provide the Fencing to the Fencing Consortium. 1.2. Purpose. It is the general purpose of this Agreement to: (a) To establish the Fencing Consortium, the responsibilities of the Members toward the Fencing Consortium, and to establish the “Fencing Consortium Joint Board” to govern the Fencing Consortium and its operations; (b) To authorize the Board to obtain and provide for the storage and deployment of Fencing in response to a Critical Incident and for other purposes as provided in this Agreement and as determined by the Board; (c) To authorize the Board to negotiate and enter into an agreement with a Vendor to obtain the Fencing and provide for its storage, delivery to, and return from a Requesting Member’s Governmental Unit; (d) To authorize the Board to establish policies and procedures for the deployment of the Fencing, the training and deployment of the Deployment Team, and on other matters as needed to achieve the purposes of this Agreement; (e) To authorize the Board to determine the Governmental Units eligible for membership in the Fencing Consortium, including expanding the eligible territory as it determines is appropriate; and (f) To authorize the Board, upon deliberation and continued communication with the Members, to revise the initial structure of the Fencing Consortium over time as it may determine is in the best interests of the Members to do things such as moving from a leasing arrangement to purchasing the Fencing and to provide for its storage, maintenance, and transportation. ARTICLE II FENCING CONSORTIUM ESTABLISHED 2.1. Established. There is hereby established, by the execution of this Agreement, the “Fencing Consortium” as a joint powers entity formed pursuant to Minnesota Statutes, section 471.59, which is to be managed and operated by the Board pursuant to the terms of this Agreement. 2.2. Scope. This Agreement applies to those Governmental Units that are Members of the Fencing Consortium and provides for the operation of the Fencing Consortium by a Board of Directors elected as provided herein. 5 CR225-476-758705.v8 ARTICLE III MEMBERSHIP 3.1. Original Members. A Governmental Unit that adopts and submits the Membership Resolution to join the Fencing Consortium before the Effective Date shall be considered an Original Member under this Agreement. A Governmental Unit is eligible to be an Original Member of the Fencing Consortium if it satisfies all of the following: (a) Is a member of the Public Works Mutual Aid Pact; (b) Is within the Seven County Metropolitan Area; (c) Has submitted a Fencing Preplan prior to the Effective Date; and (d) Has properly adopted and submitted a Membership Resolution prior to the Effective Date. The Governmental Unit shall submit its Membership Resolution to the Chief of Police in the City of Crystal. The Membership Resolutions shall be transferred to the Board once it is formed. Membership Resolutions adopted after the Effective Date shall be sent to the Board. 3.2. Additional Members. After the Effective Date, a Governmental Unit may request to become an Additional Member of the Fencing Consortium if it satisfies the following: (a) Is a member of the Public Works Mutual Aid Pact; (b) Is located within the Seven County Metropolitan Area or within the Extended Membership Area as determined by the Board; (c) Submits a Fencing Preplan; (d) Submits the fully adopted Membership Resolution; and (e) The Board votes to accept the Governmental Unit as an Additional Member. Additional Members are required to pay a Surcharge to the Fencing Consortium in the amount determined by the Board, and to comply with such additional requirements as may reasonably be imposed by the Board. 3.3. Exception. The membership requirement to be a member of the Public Works Mutual Aid Pact is to establish a mechanism through which local public works staff can be utilized to assist in the mobilization and demobilization of the Fencing within the Governmental Unit. However, there are entities that do not have their own public works staff, desire to become a Member of the Fencing Consortium, and for which local support 6 CR225-476-758705.v8 can be provided through another Governmental Unit. Therefore, a Governmental Unit that does not have a public works department or public works employees is not required to be a member of the Public Works Mutual Aid Pact to be eligible to become a Member of the Fencing Consortium, provided the following are complied with to the extent applicable: (a) If the Governmental Unit is a joint undertaking among other Governmental Units, the community in which any of the Governmental Unit’s buildings are located and to which its Fencing Preplan applies must be a member of the Public Works Mutual Aid Pact; or (b) If the Government Unit relies on the county sheriff’s department as the primary source of law enforcement services, that county must be a member of the Public Works Mutual Aid Pact. 3.4. Requirement of Good Standing. Continued membership in the Fencing Consortium shall be contingent upon: paying the annual Member Assessment and any additional charges as determined by the Board as provided herein; making public works staff available to participate as members of the Deployment Team; and on-going compliance with the other requirements, terms, and conditions of this Agreement and the policies and procedures adopted by the Board. 3.5. Withdrawing from Membership. A Member may withdraw from the Fencing Consortium as provided in Article XI of this Agreement. ARTICLE IV FENCING CONSORTIUM JOINT BOARD 4.1. Established. There is hereby established the “Fencing Consortium Joint Board.” The Board shall consist of five Directors elected by the Members in accordance with this Article. Directors shall serve without compensation from the Fencing Consortium. The Director positions shall be assigned as follows: (a) Two Directors representing law enforcement; (b) One Director representing fire; (c) One Director representing public works; and (d) One Director representing emergency managers. 4.2. Initial Directors. The Board shall initially be comprised of the following Directors (“Initial Board”): 7 CR225-476-758705.v8 (a) Ryan Murphy, Commander, Special Operations Unit, Saint Paul Police Department and Ryan Seibert, Chief of Police, City of Chaska, representing law enforcement; (b) Ward Parker, Assistant Chief Operations, City of Eden Prairie, representing fire; (c) Daniel Ruiz, Director of Operations & Maintenance, City of Brooklyn Park, representing public works; and (d) Doug Berglund, Director, Emergency Management, Washington County Sheriff’s Office, representing emergency managers. The Initial Board shall be responsible for Organizing the Board and the Fence Consortium. The Initial Board shall conduct an election in 2022 for Members to elect three Directors to the Board. An election will then be held in 2023 for Members to elect the remaining two Directors to the Board. Those elected in 2022 shall assume their positions effective on January 1, 2023 and those elected in 2023 shall assume their positions on January 1, 2024. The Initial Board shall determine which positions are up for election in 2022 and 2023, except the two law enforcement Director positions shall be elected in separate years. 4.3. Director Eligibility. To be eligible to be elected to the Board a person must be currently employed by a Member and actively serving in the profession the person is proposed to represent on the Board. If a Director loses eligibility to continue serving on the Board, the position shall be deemed vacant and the vacancy filled as provided herein. 4.4. Term. Each Director serves a two-year term commencing on January 1. The terms shall be staggered to minimize the number of Directors up for election in the same year. The Initial Board shall determine the terms and the staggering of the positions as part of adopting the bylaws. A vacancy in the office of Director shall be filled by appointment of the Board until the next election, at which time the position shall be up for election for the remainder of the term. 4.5. Election of Directors. The annual election of Directors shall occur in accordance with this Agreement and the bylaws established by the Board. This process is not subject to federal, state, or local election laws or procedures. Instead, the intent is to provide a reasonable means for Members to nominate candidates and to select those whom they wish to serve on the Board. Each Member in good standing when the nomination process begins has an opportunity to nominate people from its Governmental Unit for any or all the open positions on the Board. All persons nominated to a position must be eligible to represent that position on the Board. The Board shall collect the nominations and prepare a ballot to be distributed among the Members for a vote. Each Member in good standing shall have one vote on each open position. A Member must determine for itself who is authorized to submit nominations and cast the vote on its behalf. The name of the Member submitting the ballot must be on the ballot. The Board shall tabulate the votes and provide the Members a list of the persons elected to the Board. The conducting of 8 CR225-476-758705.v8 the nomination and election process shall occur early enough in a year to allow the newly elected Directors to take their positions on the Board as of January 1. 4.6. Director Duties. Directors are responsible for carrying out the duties of the Board under this Agreement in a diligent and timely manner. If a Director fails to attend three consecutive Board meetings without reasonable cause, the Board may declare the office vacant and fill the position by appointment. The position will then be up for election at the next election for the remainder of the term. 4.7. Board Officers. Each year at its annual meeting the Board shall elect from among its Directors a Chair and a Vice-Chair. The Board shall also appoint a Secretary/Treasurer, which is not required to be selected from among the Directors. If the Secretary/Treasurer is not a Director, the person shall not have a vote. The Chair shall act as the presiding officer at Board meetings and the Vice-Chair shall act as the presiding officer in the absence of the Chair. The Secretary/Treasurer shall take the minutes of Board meetings and shall serve as the finance manager for the Fencing Consortium. The Board shall adopt by-laws to establish its own procedures, provided such procedures are consistent with the purposes of this Agreement. 4.8. Board Meetings. The Board shall hold regular meetings on the schedule as established in its bylaws. The Board may also hold special meetings as needed upon the call of the Chair or upon the written request of two Directors given to the Secretary/Treasurer. Meetings of the Board are subject to the Minnesota Open Meeting Law (Minnesota Statutes, chapter 13D). The Secretary/Treasurer shall inform all Directors of special meetings, maintain a schedule of the Board’s regular meetings, and shall post notice of any special meetings on the bulletin board designated by the Board for such notices or, if a bulletin board is not designated, upon the outside door of the building in which the Board meets. The Board may hold emergency meetings and such other meetings as allowed by law. The Board shall hold an annual meeting in January or in such other month as designated by the Board. The annual meeting may be held together with a regular meeting. 4.9. Voting. A majority of the Directors (three) shall constitute a quorum of the Board to meet and conduct the business of the Board. Each Director shall have an equal, non- weighted, vote. Unless specifically indicated otherwise herein, a majority vote of the Directors present at a meeting, if at least a quorum is present, shall be required for the Board to take action on any issue that comes before it. A Director must be present at a meeting to vote and shall not vote by proxy. A Director may be considered present and vote from a remote location to the extent allowed under Minnesota Statutes, chapter 13D. 4.10. Powers of the Board. (a) To take all actions necessary and convenient to discharge its duty to lease Fencing and to make it available to Members pursuant to the terms of this Agreement. 9 CR225-476-758705.v8 (b) Establish policies and procedures for requesting, deploying, using, demobilizing, and returning the Fencing, and on such other operational matters as the Board may determines is appropriate. This power includes, but is not limited to, further refining the definition of Critical Incident as may be needed and otherwise identifying situations in which deployment of the Fencing is automatic and when it is discretionary with the Board. (c) Authorize one or more of its Directors to receive request from a Requesting Member and to issue a Call Out of the Fencing to a Critical Incident in accordance with established policies and procedures. (d) Obtain the Fencing initially by lease, or purchase with State appropriation, and then determine over time whether to purchase part or all of the Fencing provided under this Agreement. If the Fencing is purchased, to provide for its storage and deployment. (e) Select the notification system for the Call Out. (f) To adopt bylaws and rules or policies consistent with this Agreement as required to effectively exercise the powers, or accomplish the purposes, of the Fencing Consortium; (g) To interpret and apply the provisions of this Agreement in a manner that furthers its purpose and intent including, but not limited to, determining the eligibility of a Governmental Unit to become a Member; (h) To adopt an annual operating and capital budget, including a statement of sources of funding and allocation of costs to Members; (i) To establish a system to communicate budget and other information of interest to Members; (j) To enter into contracts in its own name; (k) Contract with an auditing firm to perform financial audits of the Fencing Consortium as the Board determines is appropriate; (l) To purchase any insurance and indemnity or surety bonds as necessary to carry out the purposes of this Agreement; (m) To seek, apply for, and accept appropriations (including legislative appropriations), grants, gifts, loans of money or other assistance as permitted by law from any person or entity, whether public or private; (n) To sue; 10 CR225-476-758705.v8 (o) To annually charge and collect from Members a Member Assessment as needed to pay the on-going costs of the Fencing Consortium; (p) To determine and require the payment of a Surcharge by Additional Members joining the Fencing Consortium; and (q) To exercise all other powers necessary and incidental to carry out the purposes of this Agreement provided such powers are consistent with the purposes of the Agreement and are exercised in accordance with the applicable statutory powers of the Members. 4.11. Powers Not Delegated. The Members expressly reserve for themselves the following powers, which shall not be deemed delegated to, and may not be exercised by, the Board: (a) Hire employees; (b) Purchase real property; (c) Issue bonds; or (d) Undertake or otherwise perform any functions exceeding the general scope and purpose of this Agreement. 4.12. Specific Duties of the Board. The Board shall exercise the powers provided it under this Agreement to perform, in addition to the other duties provided for in this Agreement, the following specific duties: (a) Lease Fence. The Board shall enter into a Lease with the Vendor to obtain the Fencing and trailer(s) for transporting the Fencing. The Board shall ensure it secures and maintains a sufficient length of Fencing to cover the Member with the longest Fencing lengths as shown on the Fencing Preplans, rounded up to the nearest 500 feet. Initially, the Board shall base the amount of Fencing on the Fencing Preplans submitted by the Original Members. As Additional Members join the Fencing Consortium, the Board shall consider the Fencing needs and may secure additional Fencing as it determines is needed. (b) Fence Storage and Transport. The Lease shall require the Vendor to store the Fencing at a location agreeable to the Board, deliver the Fencing to the identified Staging Area upon the Board’s request within the response timeframe identified in the Lease, and to address other transportation needs as specified in the Lease. (c) Select Notification System. The Board shall select a Notification Systems that will be used by Directors to Call Out the Deployment Team to a Requesting Member’s Governmental Unit. 11 CR225-476-758705.v8 (d) Reports. The Board shall prepare and distribute such reports to the Members as the Board determines are necessary to keep them informed of the Fencing Consortium’s activities. The Board shall determine the best method for distributing such reports. 4.13. Office. The initial office of the Fencing Consortium shall be selected by the Board. The Board may change the location of the office as it determines is appropriate. The Board will hold its meetings at the designated office, but may also meet at such other locations as it determines appropriate to carry out its duties. 4.14. Disbursements. Except as otherwise provided, all unbudgeted disbursements and expenditures of the Fencing Consortium shall be approved by the Board. All checks issued by the Fencing Consortium from its funds shall be co-signed by two Directors designated by the Board. 4.15. Fiscal Agent. The Board may appoint, and enter into agreements with, a fiscal agent for the Fencing Consortium and may change the fiscal agent from time to time as it deems necessary. The fiscal agent may be a Member Governmental Unit. The Board may delegate authority to the fiscal agent to act on its behalf as the Board deems appropriate and in accordance with applicable laws. ARTICLE V DEPLOYMENT OF THE FENCING 5.1. Automatic Deployment. The Fencing shall be made available for automatic deployment upon the occurrence of a Critical Incident in a Member’s Governmental Unit. The Requesting Member shall notify a Director of a Critical Incident and a Director shall utilize the designated Notification System to Call Out the Deployment Team for deployment of the Fencing. The Deployment Team shall then respond to the Requesting Member to unload and assemble the Fencing at the Deployment Site. The process to request deployment and demobilization of the Fencing shall occur in accordance with this Agreement and the policies and procedures adopted by the Board. The Deployment Team Manager shall be responsible for coordinating the deployment and demobilization of the Fencing. 5.2. Requesting Member Obligations. A Requesting Member requesting deployment of the Fencing for a Critical Incident occurring in the Member’s jurisdiction shall be responsible for the following: (a) Providing security for the Deployment Team while it is conducting its work at the Deployment Site; (b) Provide any equipment that may be needed to deploy or demobilize the Fencing that is not provided by the Vendor; 12 CR225-476-758705.v8 (c) Pay the Vendor charges for the actual use of the Fencing. Such payments are to be made directly to the Vendor unless directed otherwise by the Board; (d) Providing food, water, first aid, and similar support to the Deployment Team as may reasonably be needed; (e) Contacting the Board or the Board’s designee if there are any issues with the Fencing once it is in place; and (f) Complying with Board policies and procedures applicable to a Requesting Member, including avoiding any activities that may unreasonably damage the Fencing or expose the Deployment Team to an unreasonable risk. 5.3. Discretionary Deployment. A Member may make a request to the Board for the deployment of the Fencing in the Member’s Governmental Unit for an event or occurrence other than a Critical Incident. The deployment of the Fencing for something other than a Critical Incident is left to the sole discretion of the Board. The Board shall consider all such requests at a meeting and determine whether to approve the Member’s request. The Board shall adopt criteria or standards for determining when to allow the discretionary deployment of the Fencing and the requesting Member’s obligations if the request is approved. The Board may delegate the authority to one or more Directors to determine whether to allow the discretionary deployment of the Fencing based on the criteria established by the Board. 5.4. Non-Member Deployment. The Board shall adopt standards and requirements for determining whether to allow the deployment of the Fencing in response to a Critical Incident that occurred in a non-member Governmental Unit. Nothing in this Agreement obligates the Fencing Consortium to deploy the Fencing to a non-member Governmental Unit. 5.5. No Guarantee. The Members understand and agree the deployment of the Fencing by the Deployment Team is a cooperative undertaking and that the Fencing Consortium cannot guarantee a certain response time or make any representations or warranties regarding response times, the Fencing, its assembly, or effectiveness. The Deployment Team will endeavor to respond as quickly as possible to a Critical Incident and to place the Fencing as shown in the Requesting Member’s Fencing Preplan as provided in this Agreement and in accordance with Board policies and procedures. 5.6. Demobilization. The Member who receives the Fencing in response to a Critical Incident shall work with the Fencing Consortium to determine when to initiate the demobilization of the Fencing from the Deployment Site. For a discretionary deployment of the fence, the demobilization date shall be determined prior to the deployment. The Deployment Team shall be responsible for disassembling the Fencing as part of the demobilization. The Board shall establish such procedures and policies as may be needed to address the demobilization of the Fencing. The Board has the authority to recall the Fencing from a Member if it determines there is a more critical need for the Fencing in 13 CR225-476-758705.v8 another Governmental Unit that cannot be fulfilled by the remaining Fencing held by the Fencing Consortium. ARTICLE VI MEMBERSHIP COSTS AND ASSESSMENTS 6.1. Original Member Costs. Each Original Member shall be responsible for paying a share of the Fencing costs based on the length of fence indicated in its Fencing Preplan as a percentage of the total amount of initial Fencing to be leased by the Board. The Board shall determine the amount each Original Member is required to pay and provide each an invoice together with a sheet showing the division of costs. Invoice shall be paid within 45 days of receipt. 6.2. Additional Member Costs. Each Additional Member shall be required to pay their share of the Fencing costs calculated as if they were an Original Member. Each Additional Member shall also be required to pay a Surcharge in the amount determined by the Board. The Surcharge is to pay the Additional Member’s portion of the Member Assessment, any buy-in costs to cover a share of the Fencing and related costs, and to partially reimburse the costs paid by the existing Members. The Board shall apply the buy-in amounts collected to reduce the future charges to the existing Members. 6.3. Member Assessments. In addition to the initial Fencing costs each Member is required to pay, Members shall also be assessed for the on-going costs to operate and maintain the Fencing Consortium. These operational costs will be divided based on the Fencing costs formula and paid by each Member as a Member Assessment. The formula shall take into account the total length of Fencing held by the Fencing Consortium and then divided by the length of each Member’s Fencing needs as indicated in the Fencing Preplan. The Board shall, as part of the annual budget, determine the total amount of the Member Assessments and the specific amount to be assessed each Member to pay the anticipated Fencing Consortium costs in the upcoming year. 6.4. Payment of Member Assessments. The Fencing Consortium shall invoice Members for their Member Assessment amount for the upcoming year. Invoices are to be sent no later than January 15th in the year for which the assessment is being imposed. Members shall pay their invoices in full within 45 days from the date of the invoice. 6.5. Default. Any Member who breaches or otherwise fails to comply with the terms and conditions of this Agreement including, but not limited to, failure to pay its Member Assessment in full by the due date, shall be considered in default of this Agreement. Any dispute regarding whether a Member is in default shall be determined by a vote of the Board. A Member shall not be considered in default until it has been notified in writing by the Board of the condition placing it in default. The notice of default shall indicate the Member is not in good standing and may be expelled if the default is not cured within 90 days. If a Member fails to fully cure a default within 90 days of the notice of default, the Board may issue a written notice of expulsion from the Fencing Consortium. Upon such notice, the Governmental Unit is no longer a Member of the Fencing Consortium as if the 14 CR225-476-758705.v8 Governmental Unit voluntarily elected to terminate its membership in the Fencing Consortium as provided herein. ARTICLE VII MEMBER STAFFING REQUIREMENTS 7.1. Public Works Staff. Each Member is expected to assign member(s) of its public works staff to serve on the Deployment Team to train with the Fencing and to participate in the unloading, assembly, and demobilization of the Fencing at a Deployment Site. The providing of public works staff is through the Public Works Mutual Aid Pact and is at each Member’s own cost. 7.2. Training. The Deployment Team shall train with the Fencing at least three times a year to familiarize the Deployment Team with the Fencing and to help ensure its rapid assembly at a Deployment Site in response to a Call Out. The Board shall work with the Deployment Team to determine a reasonable training schedule that does not negatively impact their regular duties. 7.3. Employees. The members of the Deployment Team are not employees of the Fencing Consortium. The assigned members shall remain employees of their Governmental Unit for all purposes including, but not limited to, workers’ compensation coverage. 7.4. Equipment. Any damage to or loss of Member equipment utilized by the Deployment Team shall be addressed as provided in the Public Works Mutual Aid Pact. 7.5. Liability. Liability for the acts of the Deployment Team when responding to a Call Out shall be addressed in accordance with the terms of the Public Works Mutual Aid Pact. For the purposes of the Public Works Mutual Aid Pact, the Requesting Member shall be the “Requesting Party” and each of the Members assigning personnel to the Deployment Team shall be a “Sending Party.” ARTICLE VIII BUDGETING AND FINANCIAL REPORTING 8.1. Fiscal Year. The fiscal year of the Fencing Consortium is the calendar year. 8.2. Annual Budget. The Board shall prepare and adopt an annual budget as provided in this section. (a) Proposed Budget. The Board shall prepare and approve a proposed budget for the upcoming fiscal year. The proposed budget shall account for all anticipated costs in 15 CR225-476-758705.v8 the upcoming year and indicate the amounts proposed to be assessed to the Members. (b) Notice to Members. The Board shall adopt a proposed budget and distribute it to the Members by no later than June 1st each year. Members may submit written comments to the Board regarding the proposed budget by no later than July 1st. (c) Final Budget. The Board shall consider the comments received from Members and shall act to adopt a final budget by no later than August 31st. The Board shall distribute a copy of the adopted annual budget to the Members. To reduce administrative costs given the potential number of Members, the Board may send notices and otherwise communicate with Members using email messages in lieu of mailing. ARTICLE IX INSURANCE AND INDEMNIFICATION 9.1 Insurance. The Fencing Consortium shall purchase and maintain such insurance policies as the Board determines is necessary and appropriate to cover the Fencing Consortium, the Board, its operations, and, if required, the Fencing. By purchasing insurance the Members, the Fencing Consortium, and the Board do not waive, and shall not be construed as having waived, any exemptions, immunities, or limitations on liability provided by any applicable Minnesota Law, including Minnesota Statutes, Chapter 466 and section 471.59, subdivision 1a. Any uninsured liabilities incurred by the Fencing Consortium shall be paid by the Members in the same percentage as their Member Assessments as set out in this Agreement. 9.2 Director Indemnification. The Fencing Consortium shall defend and indemnify its Directors from any claim or damages levied against a Director arising out of the Director’s lawful acts or omissions made or occurring in the good faith performance of their duties on the Board. The Fencing Consortium is not required to indemnify a Director for any act or omission for which the Director is guilty of malfeasance, willful neglect of duty, or bad faith. 9.3 Member Indemnification. The Fencing Consortium shall hold the Members harmless, individually and collectively, and will defend and indemnify the Members for any claims, suits, demands or causes of action for any damages or injuries based on allegations of negligence or omissions by the Fencing Consortium. The Fencing Consortium’s duty to indemnify does not constitute, and shall not be construed as, a waiver by either the Fencing Consortium or any or all Members of any exemptions, immunities, or limitations on liability provided by law or of being treated as a single governmental unit as provided in Minnesota Statutes, section 471.59, subdivision 1a. 9.4 Liability. To the fullest extent permitted by law, this Agreement and the activities carried out hereunder thereof are intended to be and shall be construed as a “cooperative activity” and it is the intent of the Members that they, together with the Board, shall be 16 CR225-476-758705.v8 deemed a “single governmental unit” for the purposes of liability, all as set forth in Minnesota Statutes, section 471.59, subdivision 1a. For purposes of the statute, each Member to this Agreement expressly declines responsibility for the acts or omissions of the other Members. SECTION X DISPUTE RESOLUTION 10.1 Dispute Resolution Process. The Members agree to engage in good faith to attempt to resolve any disputes that may arise over the establishment, operation, or maintenance of the Fencing Consortium. If a dispute is not resolved informally, the Members agree to use the following process to attempt to resolve any dispute they may have related to the Fencing Consortium. (a) Written Notice of Dispute. Any Member with a dispute regarding the Fencing Consortium or the Board may submit a written explanation of its dispute to the Fencing Consortium and to each Member. The Board shall make the email list of Members available for the purpose of providing this notice. The explanation of the dispute must be detailed, not repetitive of a dispute already addressed by the Board regarding the same Member, relate directly to a matter within the scope of the Fencing Consortium or of the Board’s powers, and must suggest a solution. (b) Review and Response by Board. Upon the Fencing Consortium’s receipt of a written dispute it shall be placed on the agenda of the Board’s next scheduled regular meeting for consideration. The Board shall respond in writing to all properly submitted disputes within three months and shall provide each Member a copy of its response. (c) Mediation. If the Member with the dispute is not satisfied with the Board’s response, it may file a written request with the Board for mediation. If the Member and the Board are not able to mutually agree on a mediator, the Member and the Board shall each select a mediator and the two mediators shall select a third. Each party to the mediation shall be responsible for the cost of the mediator it selected and shall share equally in the costs of the mediation and of the third mediator. (d) Binding Arbitration. If the dispute is not resolved in mediation, the aggrieved Member and the Board may agree to submit to a binding arbitration process. The arbitration shall be conducted in accordance with Minnesota Statutes, chapter 572B following the Commercial Arbitration Rules of the American Arbitration Association, unless the Board and the Member agree to follow different rules. The Members and the Board agree the decision of the arbitrator shall be binding on the Fencing Consortium and its Members. 17 CR225-476-758705.v8 SECTION XI WITHDRAWAL OF A MEMBER 11.1 Process. A Member may withdraw from the Fencing Consortium by providing written notice to the Board of its intent to withdraw. To avoid a withdrawal from interrupting the on-going payments for the costs of the Fencing, the effective date of the withdrawal will depend on its timing with respect to the Board’s work to set the budget for the upcoming year. If the Board receives the withdrawal notice prior to May 1st in a year, the effective date of the withdrawal will be December 31st of the same year. If the Board receives the notice after May 1st, the withdrawal will be effective December 31st of the following year. 11.2 Effect of Withdrawal. The withdrawing Member shall be responsible for paying its full Member Assessment for the full year in which the withdrawal is effective. Recognizing the Fencing Consortium is an ongoing concern, the Members agree the withdrawing Member shall not receive any reimbursement of the amounts it has paid and is not entitled to any share in the assets of the Fencing Consortium. Upon the effective date of the withdrawal, the former Member shall no longer be considered a Member under this Agreement. SECTION XII DISSOLUTION OF FENCING CONSORTIUM 12.1 Dissolution Process. The Fencing Consortium may only be dissolved by a joint resolution approved by four-fifths of the then current Members or by a unanimous vote of the entire Board on a dissolution resolution. Dissolution shall not be effective for at least six months from the adoption the resolution unless an earlier dissolution date is approved as part of the resolution. Prior to the effective date of the dissolution, the Board shall use the Fencing Consortium’s assets to pay its outstanding obligations. If the assets on hand are not sufficient to pay all outstanding obligations, the Board shall impose a Member Assessment to collect sufficient funds to pay the outstanding amounts. The Board shall divide the amount needing to be collected by a Member Assessment using the same formula for other Member Assessments. The Fencing Consortium shall not be finally dissolved until its outstanding obligations are paid in full. 12.2 Distribution of Assets and Property. Upon dissolution, the Board shall distribute any remaining assets to the Members in proportion to the Member Assessment of each Member in effect as of the date of dissolution. The Board shall have the power to determine the best method for distributing the assets and to decide any disputes that may arise among the Members concerning such distribution. SECTION XIII MISCELLANEOUS PROVISIONS 13.1 Official Copy. This Agreement is being entered into through the adoption by each Member and the Membership Resolution. The Board shall maintain the official copy of this Agreement and maintain a list of the Original Members and the Additional Members. 18 CR225-476-758705.v8 The official copy shall constitute the Agreement, which shall be binding on all of the Members. 13.2 Data Practices. The Fencing Consortium shall comply with the requirements of Minnesota Statutes, chapter 13, the Minnesota Government Data Practices Act (“Act”). The Vendor shall be required to comply with the Act as provided in Minnesota Statutes, section 13.05. The Vendor shall be required to notify the Board if it receives a data request and to work with the Fencing Consortium to respond to it. 13.3 Notices. Any notice required or permitted to be given to the Fencing Consortium under this Agreement shall be given in writing, and shall be sent by first class mail to its current address. Notice to each Member shall be given in writing by first class mail or email to the Member’s chief of police or other designated contact person. 13.4 Waiver. The delay or failure of any party of this Agreement at any time to require performance or compliance by any other party of any of its obligations under this Agreement shall in no way be deemed a waiver of those rights to require such performance or compliance. 13.5 Governing Law. The respective rights, obligations and remedies of the parties under this Agreement and the interpretation thereof shall be governed by the laws of the State of Minnesota which pertain to agreements made and to be performed in the State of Minnesota. 13.6 Headings and Captions. The headings and captions of these paragraphs and sections of this Agreement are included for convenience or reference only and shall not constitute a part hereof. 13.7 No Third-Party Rights. This Agreement is entered into for the sole benefit of the Members and no other parties are intended to be direct or incidental beneficiaries of this Agreement, and no third party shall have any right in, under, or to this Agreement. 13.8 Good Faith. Each Member shall act in good faith. In exercising its rights and fulfilling its obligations under this Agreement, each party acknowledges that this Agreement contemplates cooperation between and among the parties. 13.9 Entire Agreement. This Agreement, including the recitals and all of the Membership Resolutions, contains the entire understanding between the Members concerning the subject matter hereof. 13.10 Amendments. Amendments to this Agreement may be proposed by the Board or by at least 10% of the Members submitting a proposed amendment to the Board. The Board shall forward proposed amendments to the Members in the form of an amendment resolution. The Board will only forward amendments proposed by Members if it determines the proposed amendments are lawful and not contrary to the primary purposes of this Agreement. Members adopting the amendment resolution shall return a copy of 19 CR225-476-758705.v8 the executed resolution to the Board. A proposed amendment shall be considered approved if the amendment resolution is adopted by at least 90% of the then current Members. 13.11 Examination of Books. Pursuant to Minnesota Statutes, section 16C.05, Subd. 5, the books, records, documents and accounting procedures and practices of the Fencing Consortium and the Vendor are subject to examination by the State. Members may examine the financial records of the Fencing Consortium upon reasonable request. 13.12 Recitals and Exhibits Incorporated. The recitals contained herein, and the Membership Resolutions, are incorporated in and made part of this Agreement. IN WITNESS WHEREOF, the Members have, by adoption and execution of the Membership Resolution, entered into this Agreement as of the Effective Date or, if an Additional Member, as of the date of acceptance by the Board of the Membership Resolution. [A list of all Members is maintained by the Fencing Consortium.] Date: August 3, 2022 Agenda Item #: VI.P. To:Mayor and City Council Item Type: Report / Recommendation From:Stephanie Hawkinson, Affordable Housng Development Manager Item Activity: Subject:Resolution No: 2022-69 Authorizing MN Department of Employment and Economic Development Grant Application for 4620 W. 77th Street Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Adopt Resolution 2022-69. INTRODUCTION: Solhem Companies is applying for financing from DEED for the development of the Fred II located at 4620 W. 77th St, a proposed 276 unit apartment building. These funds could be used to reduced the amount of financial assistance being sought from the City. ATTACHMENTS: Description Resolution No. 2022-69 RESOLUTION NO. 2022-69 AUTHORIZING GRANT APPLICATION TO MINNESOTA DEPARTMENT OF EMPLOYMENT AND ECONOMIC DEVELOPMENT FOR 4620 West 77th STREET HOUSING DEVELOPMENT BE IT RESOLVED by the City Council of the City of Edina, Minnesota, as follows: WHEREAS, the City of Edina is a statutory city eligible to apply for grant funding; and WHEREAS, the State of Minnesota Department of Employment and Economic Development is soliciting requests for grant applications to further redevelopment and employment goals; and WHEREAS, the City of Edina has identified Solhem Companies (the “Developer”) The Fred II (the “Project”) proposed to be built at 4620 West 77th Street as a project that satisfies the Redevelopment Grant purpose and criteria; and WHEREAS, the site is a 1960s era vacant office building with a large surface parking lot; and WHEREAS, it is apparent that the property's condition and value will continue to decline until it is properly repositioned and that the site appears unable to be returned to a highest and best use without grant assistance; and WHEREAS, the developer is in the process of securing preliminary zoning approvals to redevelop the site in its entirety; and WHEREAS, the developer has committed to providing the local match in order to qualify for grant assistance. BE IT RESOLVED that the City of Edina act as the legal sponsor for project contained in the Redevelopment Grant Program to be submitted on August 1, 2022 and that Mayor James B. Hovland is hereby authorized to apply to the Department of Employment and Economic Development for funding of this project on behalf of the City of Edina. BE IT FURTHER RESOLVED that the City of Edina has the legal authority to apply for financial assistance, and the institutional, managerial, and financial capability to ensure adequate project administration. BE IT FURTHER RESOLVED that the sources and amounts of the local match identified in the application are committed to the project. BE IT FURTHER RESOLVED that if the Project fails to substantially provide the public benefits listed in the application within five years from the date of the grant award, the City of Edina may be required to repay 100 percent of the awarded grant per Minn. Stat. 116J.575 Subd. 4. BE IT FURTHER RESOLVED that the City of Edina has not violated any Federal, State or local laws pertaining to fraud, bribery, graft, kickbacks, collusion, conflict of interest or other unlawful or corrupt practice. BE IT FURTHER RESOLVED that upon approval of its application by the state, the City of Edina may enter into an agreement with the State of Minnesota for the above referenced project(s), and that the City of Edina certifies that it will comply with all applicable laws and regulation as stated in all contract agreements. NOW, THEREFORE BE IT RESOLVED that the Mayor and the Clerk are hereby authorized to execute such agreements as are necessary to implement the project on behalf of the applicant. Adopted by the Edina City Council this 3rd day of August 2022. Attest: _________________________ ____________________________ Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA ) COUNTY OF HENNEPIN ) SS CITY OF EDINA ) CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached is a true and correct copy of the Resolution duly adopted by the Edina City Council at its regular meeting of August 3, 2022, and as recorded in the Minutes of said regular meeting. WITNESS, my hand and seal of said City this ______ day of________________________, 2022. _______________________________ Sharon Allison, City Clerk Date: August 3, 2022 Agenda Item #: VI.Q. To:Mayor and City Council Item Type: Report / Recommendation From:Scott H. Neal, City Manager Item Activity: Subject:Ordinance No. 2022-07: Extending Term of the Franchise Held by Comcast Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Grant first reading of Ordinance No. 2022-07 extending the term of the franchise held by Comcast of Minnesota, Inc. INTRODUCTION: The Southwest Suburban Cable Commission is comprised of five cities: Eden Prairie, Minnetonka, Richfield, Hopkins and Edina. Each member city adopted a cable franchise in 2012 which granted Comcast a 10 year franchise with an effective date of Aug. 1, 2012. The Commission has been engaged in franchise renewal activities and discussions throughout most of 2022. Due to delays finalizing the Needs Assessment Report and related matters, negotiations to renew the franchise has not been completed before the existing franchise expires on Aug. 1, 2022. Expiration of an existing cable franchise during renewal proceedings is not unusual for cable franchise renewals nor is it unusual in the cable industry. Even if the member cities took no action to extend the existing franchise, the Comcast franchise would remain in place, Comcast would continue to have authority to operate, and Comcast would be required to remit applicable fees to each city. That is because federal law provides that cable franchises remains effective until a city denies a franchise renewal request. Even though it may not be required, legal counsel to the Commission, Mr. Brian Grogan, recommends the commission cities create a written record of the extension of the franchise. The options are a simple ordinance amendment extending the franchise term, or a written agreement between the operator and the City, clarifying the mutual understanding that the existing franchise will remain in place until the renewed franchise is adopted by the City and accepted by Comcast. The Southwest Cable Commission Joint Powers Agreement does not provide the Commission with authority to amend a city ordinance (even if just to extend the franchise term). As a result, the Commission cannot address this issue via Commission action. The Commission is asking each member city to adopt a short ordinance amendment. Mr. Grogan has visited with Comcast and they have no concerns if this is not accomplished until August city council meeting(s) and then postdated back to Aug. 1, 2022 (the expiration date of the existing franchises). Attached is a draft ordinance amendment which extends the term of the Comcast franchise until Jan. 31, 2023. This should provide enough time to complete the renewal process and complete each member city’s approval process in November and December 2022. Please review the attached ordinance amendment and let me know if you have any questions or comments. ATTACHMENTS: Description Ordinance 2022-07: Extension Comcast Franchise 1 7930213v1 ORDINANCE NO. 2022-07 AN ORDINANCE EXTENDING THE TERM OF THE FRANCHISE HELD BY COMCAST OF MINNESOTA, INC. WHEREAS, on or about July 17, 2012, the City of Edina, Minnesota (“City”) granted a cable television franchise pursuant to Ordinance No. 2012-14 (“Franchise”) which is currently held by Comcast of Minnesota, Inc. (“Comcast”); and WHEREAS, the City and Comcast, pursuant to 47 U.S.C. §546(h), are currently conducting informal franchise renewal negotiations in an attempt to reach a mutually acceptable terms for franchise renewal; and WHEREAS, both the City and Comcast are interested in continuing informal renewal negotiations and desire to extend the Franchise term from August 1, 2022, to January 31, 2023; and WHEREAS, the City and Comcast have determined that an extension of the Franchise term is reasonable and in the best interest of the City, and its residents, to ensure uninterrupted cable television services; and WHEREAS, both the City and Comcast desire to expressly reserve all of their respective rights under state and federal law; and WHEREAS, the City and Comcast continue to be governed by the formal renewal process pursuant to 47 U.S.C. §546(a-g) and nothing contained herein shall in anyway diminish either party’s rights under the formal renewal process. NOW THEREFORE, THE CITY COUNCIL OF THE CITY OF EDINA, MINNESOTA HEREBY ORDAINS: Section 1. The Franchise is hereby amended by extending the term of the Franchise from August 1, 2022, through January 31, 2023. Section 2. Except as specifically modified hereby, the Franchise shall remain in full force and effect. Section 3. This Ordinance shall become effective upon adoption by the City and acceptance by Comcast. Section 4. Adopted by the City Council of the City of Edina, Minnesota this 16th day of August 2022. First reading: August 3, 2022 Second reading: August 16, 2022 ATTEST: ______________________________ _________________________________ Sharon Allison, City Clerk James B. Hovland, Mayor 2 7930213v1 ACCEPTANCE Comcast of Minnesota, Inc. hereby accepts this Ordinance and agrees to be bound by the terms and conditions of the Franchise, as amended. COMCAST OF MINNESOTA, INC. By: Its: Please publish in the Edina Sun Current on: Send two affidavits of publication Bill to Edina City Clerk Date: August 3, 2022 Agenda Item #: VI.R. To:Mayor and City Council Item Type: Other From:Sharon Allison, City Clerk Item Activity: Subject:Receive Petition for Construction of Walkways in Arneson Acres Park Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Receive petition. INTRODUCTION: The attached petition asks Council to consider construction of walkways in Arneson Acres P ark. The petition will be forwarded to Parks and Recreation Director Vetter for consideration. ATTACHMENTS: Description Petition July 25, 2022 Dear Edina City Council Members, Please take this petition into consideration when determining items to be included in planning the annual budget. One hundred eighty two people have signed this petition because of desire and need to have walkways built in Arneson Park in order to enjoy the many gardens in the park. With the aging population, there is a lack of accessibility for those unable to walk on grass. Thank you for your consideration. Respectfully submitted, Joan K Roe 5800 Creek Valley Rd Edina, MN 55439 ILVIPOR THAT `111E CITY COUNCIL It • _ C THE PROPERTIES BENEFI BY TH RSTAND IMPROVEMENTS AGAINST AMOUNTS DETERMINED HE PERSONS WHO HAVE SIGNED THIS PE IMPR AUTHORIZED BY CHAPTER 429, MINNESOTA STA r1,4z. D-0104-1? City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL D SIDEWALK 0 ALLEY PAVING ri STORM SEWER ri SANITARY SEWER 0 CURB AND GUTTER ONLY 0 PERMANENT STREET SURFACING WITH CURB AND GUTTER n WATER MAIN ID STREET LIGHTING OTHER: ilk/Ka/77S /4 7901/ese/t/ 75 To the Mayor and City Council: The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. 44_1 This pr non was circulated by: OWNER'S NAME (PRINTED) (itCf--cip 151p EL LA's -6-66 kio/J 11-6E c-r 44 14 for:. j .*-337‘ 7566 ecicnbbitint1-1 321$ LUAeg000kleS tk,4 q 3 5 -4 )fallf4A Ch- "'BONE ADDRESS PROPERTY ADDRESS (PRINTED) Arky B ge-ite e_Moof-i 112 There is space for more signatures on the back. APRIL 2008 PROPERTY OWNER'S SIGNATURE /6;6-11 OWNER'S NAME (PRINTED) Iia Ye c,7 14efrIv fko ,g 4 a h410 4ct74A=14/1 --trlAhr(tct A_Aik A-61.1 "3mLva-si-wq,_ boA 0), 0(74-7" dia(1.447 ef -CACC V P/A IN /W) i-76-JAV ADD SS / PROPERTY ADDRESS (PRINTED) 57/z Gee tilf,„, Cay 17 iv "A/ rt)AVe_. t/OV/ 6 320 Lipicrick_ In. 7/\Pkv ct 7.11il"-Y "C-1- ° 0 Nr fel (NI Aif r- goo w vee lark 164 9v9-Pl fr* )(k 60/- aco ROL FRu-s4-1wy 3aa POnevaepia )fir{ d biSacAbonVi\coac-e:D, 6S33 CfeaVadley E.-4:11,01k VOe'b ter-. “7 53 Cree ItatfAi //v/v4 Cf to-N, e_4-/y 1-71a. Ey /eeri Barba- .57:55- 7 .eee,‘__,f7,4L-5-61;ela • I This petil on was circulated by: i NAME &chei j Uh Doexv,07 e--/L ,09 \wow\ JAtIvw_- t cwo (7 /4)7.ees 4,-f(r___ L00 (-4,_ ••• _ _ PHONE The Minnesota Data Practices Act requires that we infonn you of your rights about the private data we are requesting on this form. Under the law, your telephone number is private data. This petition when submitted will become public information. There is no consequence for refusing to supply this information. You may attach extra pages with signatures. APRIL 2008 PROPERTY OWNER'S SIGNATURE grati56-eti-- J6 /6C4 4 /4,5 Kwo OWNER'S NAME (PRINTED) -takb cora- ill() L.z kAeoice 1-tneJo (JiAr.D 6x- M-(Adil 2cuitto N PROPERTY ADDRESS (PRINTED) 513 3(0 -132.(40 a' oKrnie-- ►'a Pr. 3aNtie Skouo diAvvt, coo rerta 64.0-5cecN 732,CD Cora41 Vr Silo/ 64-4r• s ss cD-ed,44 )161--/ (0(.315 41.44% 4( CtuilSe61 kir This petition was circulated by: ;41‘/ NAME ..)e-etvin W Ei nist S451. r hen ADD S The Minnesota Data Practices Act requires that we inform you of your rights about the private data we are requesting on this form. Under the law, your telephone number is private data. This petition when submitted will become public information. There is no consequence for refusing to supply this information. You may attach extra pages with signatures. APRIL 2008 IMPOR THAT TH it, CITY COUNCIL THE PROPERTIES BENEFI BY T AUTHORIZED BY CHAPTER 429, MINNESOTA STA HE PERSONS WHO HAVE SIGNED THIS PE RSTAND INIPROVEMENTS AGAINST AMOUNTS DETERMINED C IMPR PROPERTY OWNER'S SIGNATURE City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX 7 (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL in SIDEWALK 111 ALLEY PAVING q STORM SEWER 0 SANITARY SEWER q CURB AND GUTTER ONLY 0 PERMANENT STREET SURFACING WITH CURB AND GUTTER To the Mayor and City Council: q WATER MAIN q STREET LIGHTING k„TI OTHER: 14/9-ixaRy_s- in novism/ /ha The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. Mato reds.,1 t rea. Bry Son JaviG t. D Vt OWNER'S NAME (PRINTED) „Id; c5: 9 del -411,)-4 5i 2- CAre-stwo Q Ed; 'wt. ('J7?- t/ e-y V)e•mi ,601iela 7 I 3 Cd vn ca Pt C. t•-t. 1)00 3C;S'i-c) 1 B) yet Fogel-A PROPERTY ADDRESS (PRINTED) This petition was circulated by: ADDRESS f —I There is space for more signatures on the back. APRIL 2008 /..dg• AZOIMffivi / #A 4410 ( AMA al lAr This petiti n was circulated by: GtC NAME City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL SIDEWALK q ALLEY PAVING ri WATER MAIN ri STORM SEWER q SANITARY SEWER EI STREET LIGHTING ri CURB AND GUTTER ONLY El PERMANENT STREET q OTHER: SURFAING WITH CURB AND GUTTER To the Mayor and City Council: The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. IMPORTANT NOTE: THE PERSONS WHO HAVE SIGNED THIS PETITION UNDERSTAND THAT THE CITY COUNCIL MAY ASSESS TM', COSTS OF THESE IMPROVEMENTS AGAINST THE PROPERTIES BENEFITING FROM TH IMPROVEMENTS IN AMOUNTS DETERMINED BY THE COUNCIL AS AUTHORIZED BY CHAPTER 429, MINNESOTA STATUTES. PROPERTY OWNER'S SIGNATURE OWNER'S NAME (PRINTED) PROPERTY ADDRESS (PRIM ELD) s c_ 17Ktvr 6 4,k,n; jY 1,L)Ar re-A 1 . `54 7/47 0 P.1 4,4,/,‘„ ADDRESS rn , s/er A-Nnae_ cf1.644, guleA4 Iter There is space for more signatures on the back. APRIL 2008 PROPERTY OWNER'S SIGNATURE OWNER'S NAME (PRINTED) can Jc7A,1 4-) M/i-gy 577) L.7744/// ri Any Carer A. 6 PIAC.L—OR iC1-4 AA P-1 1%M /2f, rel (4C-f-Gr44-r bt.) pr '1 —r (74 (71/J(izz2L, i3-01eA/A-6Mre- ?4--Ly ,q-(\/0 JuKK0V) ly !_v/e3///tr,e- Delonr-0-.P PiGint-4 kl1,‘,e kii/Ar fAA----5-56z,,Avatz Lo +heir eoe.0 *ell& r\fuo c*--7.2•S' 5-5-14 17 V RP- , vicc .fie .66O1 PROPERTY ADDRESS (PRINTED) 613 - fi-irctL/Cs- 6ti 56,13 (ie fobt cfz_ 51,09 oafit 0w.k. / 7 Ccrve—t\ 1)-W1 6 r413 Eft fki-Weg, .72,c,s-&; rri • 'pv 6190 a' /1-5 9s I S'gbeil-1 L-45 w 'it. cirlik?,L ri (9,M1 OjkLid .41/g 652/3 7/45c7/if#Tio 4941/4 40,„7,0 40/ te,idc,ftcZ(0 s-<-L,3/49 0<; nwit 3g ),e,rkeci. Atie-- 4'6?) }Qv& Ave,S This petition was circulated by: i'for ae„i NAME ADDRESS 7 The Minnesota Data Practices Act requires that we inform you of your rights about the private data we are requesting on this form. Under the law, your telephone number is private data. This petition when submitted will become public information. There is no consequence for refusing to supply this information. You may attach extra pages with signatures. APRIL 2008 City of Edina, Minnesota tg CITY COUNCIL 4? 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL SIDEWALK ri ALLEY PAVING El STORM SEWER n SANITARY SEWER ri CURB AND GUTTER ONLY 111 PERMANENT STREET SURFACING WITH CURB AND GUTTER To the Mayor and City Council: n WATER MAIN n STREET LIGHTING q ompa: The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. IMPORTANT NOTE: THE PERSONS WHO HAVE SIGNED THIS PETITION UNDERSTAND THAT THE CITY COUNCIL MAY ASSESS THE, COSTS OF THESE IMPROVEMENTS AGAINST THE PROPERTIES BENEFITING FROM THE IMPROVEMENTS IN AMOUNTS DETERMINED BY THE COUNCIL AS AUTHORIZED BY CHAPTER 429, MINNESOTA STATUTES. PROPERTY ADDRESS (PRINTED) 6 jealc-ZA[-4a 6r 4-0070142L c44-CU-V‘-'WC1/4, 4. I S- It, tmi Ly ciMgtiA( 71/6 4/04,11 h IM K1 (s) e -1).1\)D was circulated by: a,' NAME ADDRE PHONE There is space for more signatures on the back. APRIL 2008 PROPERTY OWNER'S SIGNATURE oppitiptal OkAANZA, • „At -dick OWNER'S NAME (PRINTED) cam( (41 !ff 0'7 / PROPERTY OWNER'S OWNER'S NAME SIGNATURE (PRINTED) At mP irc 79,0-44-1e(-;/(C t16?ie 6t_ n,d) Trfiwtztoi 11 Med 64 5em/6._ Sa_pt at( Chi UP -flu-4,-) ham; IA line-f) (ea ETt tr 9 ,O K44 rq (AlE1(tAtAniVeun M co, In..1 ct-CAP-nc-tftr) Ait/A/ant e-rc, a- `74— .5CL‘r PROPERTY ADDRESS (PRINTED) ' 4,536 or, 17,J g Dailqw.or . G9r154,e'( /eel (a541? 01)6,rrco 4 s- giD 64c4e.e) due 6 9 /3 ic-22,7e,., 4e/u, Ige ?,9,0("W,,,,i'd&a(Ae 5: Liiiia5GokLisok) 4,N „v, 7015 La gdckAJ AA\Je d6ce OectArS-tv . &(1,3_ • L AL. a, . 4 /. A ,S116.,ro1v )1/. r.&tt" J ran r S/A/1.-- ey Ok1 e ( 0 peA-riA 36 ett,r1 nis—e /177 ► LAp (2,e ( 7 2 me,./frook •-•1\ \j\-\\xs \ED \\--(z. s L1/4._.r.), d 51 16 art This petition was circulated by: NAME ADDRESS The Minnesota Data Practices Act requires that we inform you of your rights about the private data we are requesting on this form. Under the law, your telephone number is private data. This petition when submitted will become public information. There is no consequence for refusing to supply this information. You may attach extra pages with signatures. APRIL 2008 PERSONS WHO HAVE SIGNED THIS PE ii I • '1 II" AUTHORIZED BY CHAPTER 429, MINNESOTA STA RSTAND IMPROVEMENTS AGAINST AMOUNTS DETERMINED IMPOR THAT THE CITY COUNCIL THE PROPERTIES BENEFI BY T • PROPERTY OWNER'S SIGNATURE OWNER'S NAME (PRINTED) A 1-1" A c).s• s c.t ofv\ -c/AA4---- 4 me d-r C r id EL,-,171 _s(aS gLtiuklikti;i Pele,be, 4)-1-11 tiv City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL SIDEWALK 0 ALLEY PAVING 0 STORM SEWER D SANITARY SEWER 0 CURB AND GUTTER ONLY 0 PERMANENT STREET SURFACING WITH CURB AND GUTTER To the Mayor and City Council: 0 WATER MAIN 0 STREET LIGHTING OTHER: 14/4-ixkm ys //9 &4/456 V /19-ia The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. PROPERTY ADDRESS (PRINTED) 127 5501 cti` k 1 Q‘ "1/1 .1)/rote 17 0 /14_ CA_ t4. C- 1.3 7d '1,6 (CO4 S_.e.; (-Y-• I -1 P P4-1< e. ift tA-4)- This petition was circulated by: tv—t. vt, C 8' 3 7 7-9„---,x — NAME ADDRESS PHONE There is space for more signatures on the back. APRIL 2008 ST ED 1.11 fdlniL.t ► OrTE:z- 0 - PERSONS WHO HAVE SIGNED THIS PET N UNDERS ol ierra 411"lik, " VI r Uttb trjr.G.1 IMP Pal Si IThidi nal • w ; n I • i ""rn ,111 IL AS AUTHO ' ED CHAPTER 429, City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL I SIDEWALK E ALLEY PAVING I-7 STORM SEWER q SANITARY SEWER 0 CURB AND GUTTER ONLY 0 PERMANENT STREET SURFACING WITH CURB AND GUTTER To the Mayor and City Council: El WATER MAIN 111 STREET LIGHTING lEr,OTHER: Waa-1,ca The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, 4ncluding but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. •pROPERTY OWNER'S OWNER'S NAME SIGNATURE (PRINTED) 5t(ti gjaii/Wr 6,.j( Tee)/ e d-14 r This petition was circulated by: 7oi?, B(vc( NAM ADDRESS PROPERTY ADDRESS (PRINTED) V10 642-4 5611 it2eA 5-9/3y &e( xi d73111 Nei dzy 5 , 2q 5te-e YjAct.ivi Ave_ PHONE c-11/1.4 There is is space for more signatures on the back. APRIL 2008 OTHER: VVV/ad/Iy_s- /9Avesa4/ HORIZED : • ' TER 429, Mk, TA STA ---- WON—II S WHO HAVEak NED THIS PE NDE RSTAND Nal 0.1. A -`:I I l' ' 0 MENTS • td• I ST i • . I ' R e somir.h AMOU TS D ' I I ED T HE BY TH PROPERTY OWNER'S SIGNATURE This petition was circulate by: NAME OWNER'S NAME (PRINTED) C3‘,J4-,kk, 51m ZA&___ (01) i3)f\ 4--oHca Uingat 70 (3 1(3--(i 5404 64,-4 ADDRESS City of Edina, Minnesota CITY COUNCIL 4801 West 50th Street • Edina, Minnesota 55424 (952) 927-8861 • (952) 927-7645 FAX • (612) 927-5461 TDD DATE RECEIVED: PETITION TO THE CITY COUNCIL SIDEWALK q ALLEY PAVING 111 WATER MAIN ri STORM SEWER n SANITARY SEWER 111 STREET LIGHTING 1-1 CURB AND GUTTER ONLY EI PERMANENT STREET SURFACING WITH CURB AND GUTTER To the Mayor and City Council: The persons who have signed this petition ask the City Council to consider the improvements listed above to the locations listed below. Request for solid surface walkways within Arneson Park to enable residents of all abilities access to the park gardens. This would allow use by all, including but not limited to, users aided by wheelchairs, walkers or canes, as well as parents with children in strollers. Design planning to include: pleasing aesthetics, minimal disturbance to existing trees, environmentally supportive and limited to use by pedestrians only. PROPERTY ADDRESS (PRINTED) eg 3;;( -7 Or* KA R& 67-405 i=tagq (1)3121 There is space for more signatures on the back. APRIL 2008 51-== H i r), 0-11, eilmvp=p, inuit gkR/./aar V As A-NT i 7A KAIMPV Srleif 41 441:1101-4 of ex ainG 40\i'W6-A_ es_$sic GA Clctv\V (awl ikkj-k-A Scli"j This petition was circulated by: PI,t)t-k M c.re-c)n, v) \la r i PROPERTY OWNER'S SIGNATURE S/K7'7 / OWNER'S NAME (PRINTED) 1. a L.1-it-G1 /31 / 5 PROPERTY ADDRESS (PRINTED) ifs • -? , -7 4) 1-7 Drc:-,07j1 1011 bristo-,8f \ic? 7 o 1 2;,s--/-b I v .1-17i4, 1i) tiro qidatt 5511 7 Dom,-LLI ,(41,„-e..._ ) 91 50 Oa/4(1(Pd 16i`Ca (3a (IC eTaj,cL, Neuic-,s-re,s-r -sx3-goutud gctek &L)/1zAk Poll • N55 e ver NI le ),,e2 &005 aYmiQ Oathsk (5 1 CAWO Ati S € C%(4 1-e, 5SD5 MitSicit eie.de 7//0/ 10/0)5"t 6g- il-Pabk-ic:Dr L. NAME ADDRESS rnuNi The Minnesota Data Practices Act requires that we inform you of your rights about the private data we are requesting on this form. Under the law, your telephone number is private data. This petition when submitted will become public information. There is no consequence for refusing to supply this information. You may attach extra pages with signatures. APRIL 2008 Date: August 3, 2022 Agenda Item #: VII.A. To:Mayor and City Council Item Type: Report / Recommendation From:Sharon Allison, City Clerk Item Activity: Subject:PUBLIC HEARING: People's Organic Liquor License Suspension Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Motion approving People's Organic's 3-day liquor license suspension and $1,000 fine for their second liquor license offense within 24 months. INTRODUCTION: On June 14, 2022, alcohol was sold to an under 21-year-old police decoy during an alcohol compliance check by the Edina Police Department. This was People's Organic's second offense within 24 months and the presumptive civil penalty is a 3-day liquor license suspension and $1,000 fine. Pursuant to MN Statute 340A.415, the maximum suspension is 60 days and the maximum fine is $2,000. Per City Code, Chapter 4, Alcoholic Beverage, Sec. 4-14-2, and in accordance with MN Statute 340A.415, the licensee must be given the opportunity for a hearing. Staff recommends Monday-Wednesday, August 8-10, for the 3-day suspension. Staff also recommends that People's Organic decides how to notify their customers of the 3-day suspension, for example, by posting a notice on entry door(s) and also where alcohol is in plain sight of customers. Lt. Dan Conboy will be in attendance to answer any questions the Council may have related to the violation. Date: August 3, 2022 Agenda Item #: VIII.A. To:Mayor and City Council Item Type: Report / Recommendation From:Sharon Allison, City Clerk Item Activity: Subject:Resolution No. 2022-71: Accepting Donations Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Resolution No. 2022-71 accepting donations. INTRODUCTION: To comply with State Statute, all donations to the City must be accepted by resolution and approved by two- thirds majority of the Council. See attached resolution with list of donations. ATTACHMENTS: Description Resolution No. 2022-71: Accepting Donations RESOLUTION NO. 2022-71 ACCEPTING DONATIONS ON BEHALF OF THE CITY OF EDINA WHEREAS, Minnesota Statute 465.03 allows cities to accept grants and donations of real or personal property for the benefit of its citizens; WHEREAS, said donations must be accepted via a resolution of the Council adopted by a two thirds majority of its members. NOW, THEREFORE, BE IT RESOLVED, that the Edina City Council accepts with sincere appreciation the following listed grants and donations on behalf of its citizens. Parks & Recreation Jeri Albrecht $3,200 Bench at Centennial Lakes Dated: August 3, 2022 Attest: Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA ) COUNTY OF HENNEPIN) SS CITY OF EDINA ) CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached and foregoing Resolution was duly adopted by the Edina City Council at its Regular Meeting of August 3, 2022, and as recorded in the Minutes of said Regular Meeting. WITNESS my hand and seal of said City this _______ day of ___________________, 2022. City Clerk Date: August 3, 2022 Agenda Item #: VIII.B. To:Mayor and City Council Item Type: Other From:Tiffany Bushland, General Manager-Centennial Lakes Park Item Activity: Subject:Resolution No. 2022-67: Accepting Donation from Dennis W. Schulstad Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Resolution No. 2022-67 accepting donation from Dennis W. Schulstad for a bronze statue and upgraded landscaping at Centennial Lakes P ark with a value of $25,000. INTRODUCTION: To comply with State Statute, all donations to the City must be accepted by resolution and approved by two thirds majority of the City Council. ATTACHMENTS: Description Resolution No. 2022-67: Accepting Donation from Dennis W. Schulstad Staff Report: Accepting Donation from Dennis W. Schulstad Restrict Donation Agreement RESOLUTION NO. 2022-67 ACCEPTING DONATIONS ON BEHALF OF THE CITY OF EDINA WHEREAS, Minnesota Statute 465.03 allows cities to accept grants and donations of real or personal property for the benefit of its citizens; WHEREAS, said donations must be accepted via a resolution of the Council adopted by a two thirds majority of its members. WHEREAS, Dennis W. Schulstad, 6303 Rose Court, Edina, MN 55424 wishes to donate funds to fabricate and install a bronze statue and upgrade landscaping at Centennial Lakes Park; WHEREAS, donor will donate $25,000 to fund the project; WHEREAS, said donation will be deposited to City of Edina’s Centennial Lakes Park fund following acceptance of this resolution; NOW, THEREFORE, BE IT RESOLVED, that the Edina City Council accepts with sincere appreciation the following donation on behalf of its citizens. Parks & Recreation- Centennial Lakes Park Dennis W. Schulstad $25,000-- Artwork and landscaping- Centennial Lakes Park Dated: August 3, 2022 Attest: Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA ) COUNTY OF HENNEPIN) SS CITY OF EDINA ) CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached and foregoing Resolution was duly adopted by the Edina City Council at its Regular Meeting of August 3, 2022, and as recorded in the Minutes of said Regular Meeting. WITNESS my hand and seal of said City this _______ day of ___________________, 2022. City Clerk August 3, 2022 Mayor and City Council Tiffany Bushland, Centennial Lakes Park General Manager Resolution No. 2022-67: Accepting Donation from Dennis W. Schulstad Information / Background: Dennis W. Schulstad desires to make a gift to the City of Edina to fund a memorial for his wife, Pam Schulstad, at Centennial Lakes Park. City staff and the donor worked through memorial ideas and the donor selected a bronze statue created by artist Nick Legeros. The piece of artwork will be placed along the lake in the southwest portion of Centennial Lakes Park. The plantings and landscape surrounding the bronze statue will also be enhanced. Dennis W. Schulstad already donated $25,000 to the Edina Community Foundation to complete this project and the Foundation will provide the City with a check once the project has been completed. Any remaining funds, at the donor’s request, will be used for the upkeep of Centennial Lakes Park and its programs. Artist Nick Legeros worked with the donor to create a piece of original artwork. Dennis and his wife Pam often utilized Centennial Lakes Park to take their golden retriever for walks. The artwork will honor this cherished activity and provide a great addition to the artwork at Centennial Lakes Park. The bronze statue will be placed on a solid block of Chilton limestone. City staff will complete installation of adjacent plantings and landscape. Date: August 3, 2022 Agenda Item #: VIII.C. To:Mayor and City Council Item Type: Report / Recommendation From:Scott H. Neal, City Manager Item Activity: Subject:Ordinance No. 2022-06: An Interim Ordinance Prohibiting the Sale, Testing, Manufacturing, and Distribution of THC Products Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Ordinance No. 2022-06, an interim ordinance prohibiting the sale, testing, manufacturing, and distribution of THC products, and grant second reading. INTRODUCTION: Ordinance No. 2022-06 is an ordinance imposing a one-year moratorium on the retail sales of THC-infused edibles and drinks within the City of Edina. The purpose of the moratorium is to provide sufficient time for City staff to study the issues related to the development of a municipal system of regulation and licensure of the retail sales of these materials. A number of other Minnesota cities are adopting similar moratoriums for the same or similar purposes. This ordinance has been drafted by the City Attorney and meets the standards for municipal moratorium ordinances. If Ordinance No. 2022-06 is approved on first reading by the City Council at the July 19 Council meeting, staff will schedule a second reading for the ordinance at the Council’s August 3 meeting. If approved at the August 3 meeting, the ordinance will become effective immediately. First reading was approved July 19, 2022. ATTACHMENTS: Description Ordinance No. 2022-06: An Interim Ordinance Prohibiting the Sale, Testing, Manufacturing, and Distribution of THC Products 222594v1 ORDINANCE NO. 2022-06 AN INTERIM ORDINANCE PROHIBITING THE SALE, TESTING, MANUFACTURING, AND DISTRIBUTION OF THC PRODUCTS NOW, THEREFORE, the City Council of the City of Edina does ordain: SECTION 1. BACKGROUND. 1. By enacting 2022 Session Law Chapter 98, Article 13, the Minnesota Legislature amended Minn. Stat. §151.72 and permitted the sale of edible and nonedible cannabinoid products that contain no more than 0.3 % of Tetrahydrocannabinol, commonly known as THC (“THC Products”). 2. The new law does enact some requirements for labeling and testing, but the law provides no parameters regulating production, compliance checks, or sales of THC Products. The new law does not prohibit local regulation. 3. Pursuant to Minn. Stat. § 462.355, subd. 4, the City is authorized to enact by ordinance a moratorium to regulate, restrict or prohibit any use within the jurisdiction to protect the public health, safety, and welfare. Specifically, the City is authorized to enact a moratorium ordinance to allow it to undertake a study to determine whether to adopt any regulations or restrictions, including siting and location of uses, related to the sales, testing, manufacturing, and distribution of THC Products. 4. Pursuant to its general police powers, including but not limited to, Minn. Stat. § 421.221, subd. 32, the City may enact and enforce regulations or restrictions on THC Products within the City to protect the public safety, health, and welfare, including restrictions and a moratorium on the use of sales, testing, manufacturing, and distribution, during the pendency of a study to determine the need for police power regulations, including but not necessarily limited to licensing and permitting. SECTION 2. FINDINGS. 1. The City Council finds there is a need to study THC Products and uses and businesses related thereto, in order to assess the necessity for and efficacy of regulation and restrictions relating to the sales, testing, manufacturing, and distribution of THC Products, including through licensing or zoning ordinances, in order to protect the public health, safety, and welfares of its residents. 2. The study will allow the City Council to determine the appropriate changes, if any, that that it should make to City ordinances. 3. The City Council, therefore, finds that there is a need to adopt a City-wide moratorium of the sale, testing, manufacturing, and distribution of THC Products within the City while City staff studies the issue. SECTION 3. MORATORIUM. 1. No individual, establishment, organization, or business may sell, test, manufacture, or distribute THC Products for twelve (12) months from the effective date of this ordinance. 222594v1 2. The City shall not issue any license or permit related to THC Products or twelve (12) months from the effective date of this ordinance. No license or permit application, of any kind, by any individual, establishment, organization, or businesses involved in the proposed sale, testing, manufacturing, or distribution of THC Products within the City of Edina shall be accepted or considered for twelve (12) months from the effective date of this ordinance. 3. Planning or zoning applications related to THC Products or applications from individuals, establishments, organizations, or businesses involved in the proposed sale, testing, manufacturing, or distribution of THC Products within the City of Edina shall not be accepted or considered for twelve (12) months from the effective date of this ordinance. SECTION 4. STUDY. The City Council directs City staff to study the need for local regulation regarding the sale, testing, manufacturing, or distribution of THC Products within the City of Edina. Staff must also study the need for creating or amending zoning ordinances, licensing ordinances, or any other ordinances to protect the citizens of Edina from any potential negative impacts of THC Products. Upon completion of the study, the City Council, together with such commission as the City Council deems appropriate, or as may be required by law, will consider the advisability of adopting new ordinances or amending its current ordinances. SECTION 5. ENFORCEMENT. The City may enforce this Ordinance by mandamus, injunctive relief, or other appropriate civil remedy in any court of competent jurisdiction. The City Council hereby authorizes the City Manager, in consultation with the City Attorney, to initiate any legal action deemed necessary to secure compliance with this Ordinance. A violation of this Ordinance is also subject to the City’s general penalty in City Code § Sec. 1-18 subd. (b). SECTION 6. TERM. Unless earlier rescinded by the City Council, the moratorium established under this Ordinance shall remain in effect until twelve (12) months from its effective date, at which point, it will automatically expire. SECTION 7. EFFECTIVE DATE. This Ordinance shall be in full force and effect from and after its passage by the City Council. This ordinance is effective upon adoption. First reading: July 19, 2022 Second reading: August 3, 2022 ATTEST: ______________________________ _________________________________ Sharon Allison, City Clerk James B. Hovland, Mayor Please publish in the Edina Sun Current on: Send two affidavits of publication Bill to Edina City Clerk Date: August 3, 2022 Agenda Item #: VIII.D. To:Mayor and City Council Item Type: Other From:Sharon Allison, City Clerk Item Activity: Subject:Approve Summary Publication for Ordinance No. 2022-06 Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve summary publication for Ordinance No. 2022-06, an interim ordinance prohibiting the sale, testing, manufacturing, and distribution of THC products. INTRODUCTION: State Statute requires that the City publish all approved ordinances within 45 days of approval in its official newspaper. State Statute allows cities to choose to publish a summary of a complete public notice. This is a cost effective option for lengthy ordinances. To comply with State Statue, summary publications must be approved by four-fifths majority of the Council. ATTACHMENTS: Description Summary Publication for Ordinance 2022-06 CITY OF EDINA HENNEPIN COUNTY, MINNESOTA SUMMARY ORDINANCE NO. 2022-06 AN INTERIM ORDINANCE PROHIBITING THE SALE, TESTING, MANUFACTURING, AND DISTRIBUTION OF THC PRODUCTS NOTICE IS HEREBY GIVEN that, on August 3, 2022, Ordinance No. 2022-06 was adopted by the City Council of the City of Edina, Minnesota. NOTICE IS HEREBY GIVEN that, due to the lengthy nature of Ordinance No. 2022-06, the following summary of the ordinance has been prepared for publication and approved by the City Council as authorized by state law. MORATORIUM 1. No individual, establishment, organization, or business may sell, test, manufacture, or distribute THC Products for twelve (12) months from the effective date of this ordinance. 2. The City shall not issue any license or permit related to THC Products or twelve (12) months from the effective date of this ordinance. No license or permit application, of any kind, by any individual, establishment, organization, or businesses involved in the proposed sale, testing, manufacturing, or distribution of THC Products within the City of Edina shall be accepted or considered for twelve (12) months from the effective date of this ordinance. 3. Planning or zoning applications related to THC Products or applications from individuals, establishments, organizations, or businesses involved in the proposed sale, testing, manufacturing, or distribution of THC Products within the City of Edina shall not be accepted or considered for twelve (12) months from the effective date of this ordinance. The complete ordinance is available by contacting Sharon Allison at sallison@EdinaMN.gov or 952-826-0408. APPROVED for summary publication by the City Council this 3rd day of August 2022. By order of the Edina City Council Sharon Allison City Clerk Please publish in the Edina Sun Current on August 18, 2022 Send one affidavit of publication. Bill to Edina City Clerk Date: August 3, 2022 Agenda Item #: VIII.E. To:Mayor and City Council Item Type: Report / Recommendation From:Alisha McAndrews, Finance Director Item Activity: Subject:Resolution No. 2022-70: Awarding the Sale of $17 million General Obligation Temporary CIP Bonds, Series 2022B Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Approve Resolution No. 2022- awarding the Sale of $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B. INTRODUCTION: The issuance of the General Obligation Temporary Bonds, Series 2022B, includes temporary financing for the site acquisition and initial design of the City’s Fire Station #2 project, as adopted within the Capital Improvement Bond Plan on June 21, 2022. The bonds’ debt service will be paid with a combination of capitalized interest, included in the issuance, and the balance will be refinanced with up to $39 million of General Obligation Bonds providing long-term financing payable from a dedicated tax levy for the full project. No tax levy is anticipated during this temporary period. Bids will be received and tabulated by the City's financial advisor, Ehlers & Associates, Inc. on Tuesday, August 3, and the results presented to the City Council that evening. The City requested bond ratings from both Moody's and S&P. Both agencies assigned a "AAA" rating to this issuance. Credit strengths highlighted as "Very Strong" include: Economy Budgetary performance and flexibility Management, financial policies and practices Liquidity A credit challenge mentioned by S&P is the increasing debt burden over the next several years, including a significant increase if the local option sales tax referendum is approved by voters this fall. Both S&P's and Moody's credit reports are attached. A final resolution will be provided August 3 once the bond sale has been completed. ATTACHMENTS: Description Pre Sale Report GO Bonds 2022B Preliminary Official Statement GO Bonds 2022B Resolution No. 2022-70: Awarding the Sale of General Obligation Bonds Series 2022B Moody's Rating Report General Obligation Rating Report Ehlers Presentation Proposal Form Sale Day Report City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Assumes Current Market Non-BQ AAA/Aaa Rates + 50bps Sources & Uses Dated 08/25/2022 | Delivered 08/25/2022 Sources Of Funds Par Amount of Bonds $17,000,000.00 Total Sources $17,000,000.00 Uses Of Funds Total Underwriter's Discount (0.500%)85,000.00 Costs of Issuance 92,000.00 Deposit to Capitalized Interest (CIF) Fund 670,083.33 Deposit to Project Fund 16,152,916.67 Total Uses $17,000,000.00 Series 2022B GO Temp CIP | SINGLE PURPOSE | 6/30/2022 | 9:02 AM City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Assumes Current Market Non-BQ AAA/Aaa Rates + 50bps Debt Service Schedule Date Principal Coupon Interest Total P+I Fiscal Total 08/25/2022 ----- 08/01/2023 --436,333.33 436,333.33 - 02/01/2024 --233,750.00 233,750.00 670,083.33 08/01/2024 --233,750.00 233,750.00 - 02/01/2025 17,000,000.00 2.750%233,750.00 17,233,750.00 17,467,500.00 Total $17,000,000.00 -$1,137,583.33 $18,137,583.33 - Yield Statistics Bond Year Dollars $41,366.67 Average Life 2.433 Years Average Coupon 2.7500000% Net Interest Cost (NIC)2.9554794% True Interest Cost (TIC)2.9576170% Bond Yield for Arbitrage Purposes 2.7436429% All Inclusive Cost (AIC)3.1906993% IRS Form 8038 Net Interest Cost 2.7500000% Weighted Average Maturity 2.433 Years Series 2022B GO Temp CIP | SINGLE PURPOSE | 6/30/2022 | 9:02 AM City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Assumes Current Market Non-BQ AAA/Aaa Rates + 50bps Net Debt Service Schedule Date Principal Coupon Interest Total P+I CIF Net New D/S Fiscal Total 08/25/2022 ------- 08/01/2023 --436,333.33 436,333.33 (436,333.33)-- 02/01/2024 --233,750.00 233,750.00 (233,750.00)-- 08/01/2024 --233,750.00 233,750.00 -233,750.00 - 02/01/2025 17,000,000.00 2.750%233,750.00 17,233,750.00 -17,233,750.00 17,467,500.00 Total $17,000,000.00 -$1,137,583.33 $18,137,583.33 (670,083.33)$17,467,500.00 - Series 2022B GO Temp CIP | SINGLE PURPOSE | 6/30/2022 | 9:02 AM This Preliminary Official Statement and the information contained herein are subject to completion and amendment. These securities may not be sold nor may offers to buy be accepted prior to the time the Official Statement is delivered in final form. Underno circumstances shall this Preliminary Official Statement constitute an offer to sell or the solicitation of an offer to buy these securities nor shall there be any sale of these securities in any jurisdiction in which such offer, solicitation or sale would be unlawfulprior to registration or qualification under the securities laws of any such jurisdiction. This Preliminary Official Statement is in a form deemed final as of its date for purposes of SEC Rule 15c2-12(b) (1), but is subject to revision, amendment and completionin a Final Official Statement.PRELIMINARY OFFICIAL STATEMENT DATED JULY 21, 2022 In the opinion of Dorsey & Whitney LLP, Bond Counsel, based on existing law and assuming the accuracy of certain representations and compliance with certain covenants, interest on the Bonds (i) is excluded from gross income for federal income tax purposes under Section 103 of the Internal Revenue Code of 1986 (the "Code"), (ii) is not an item of tax preference for purposes of the federal alternative minimum tax imposed by Section 55 of the Code, (iii) is excluded from taxable net income of individuals, estates, and trusts for Minnesota income tax purposes, and (iv) is not an item of tax preference for Minnesota alternative minimum tax purposes. Interest on the Bonds is included, however, in net income for purposes of the Minnesota franchise tax imposed on corporations and financial institutions. See "TAX CONSIDERATIONS" herein. New Issue Rating Applications Made: Moody's Investors Service, Inc. and S&P Global Ratings CITY OF EDINA, MINNESOTA (Hennepin County) $17,000,000* GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B PROPOSAL OPENING: August 3, 2022, 10:00 A.M., C.T.CONSIDERATION: August 3, 2022, 7:00 P.M., C.T. PURPOSE/AUTHORITY/SECURITY: The $17,000,000* General Obligation Temporary Capital Improvement Plan (CIP) Bonds, Series 2022B (the "Bonds") are being issued by the City of Edina, Minnesota (the "City") pursuant to Minnesota Statutes, Sections 475.521 and 475.61, and Chapter 475, as amended, for the purpose of financing the site acquisition and design for the City's Fire Station No. 2 project. The Bonds are general obligations of the City, for which its full faith, credit and taxing powers are pledged. Delivery is subject to receipt of an approving legal opinion of Dorsey & Whitney LLP, Minneapolis, Minnesota. DATE OF BONDS: August 25, 2022 MATURITY: February 1 as follows: Year Amount* 2025 $17,000,000 MATURITY ADJUSTMENTS: * The City reserves the right to increase or decrease the principal amount of the Bonds on the day of sale, in increments of $5,000 each. Increases or decreases may be made in any maturity. If any principal amounts are adjusted, the purchase price proposed will be adjusted to maintain the same gross spread per $1,000. INTEREST: August 1, 2023 and semiannually thereafter. OPTIONAL REDEMPTION: Bonds maturing on February 1, 2025 and thereafter are subject to call for prior optional redemption on February 1, 2024 and any date thereafter, at a price of par plus accrued interest. MINIMUM PROPOSAL: $16,915,000. GOOD FAITH DEPOSIT: A good faith deposit in the amount of $340,000 shall be made by the winning bidder by wire transfer of funds. PAYING AGENT: U.S. Bank Trust Company, National Association BOND COUNSEL: Dorsey & Whitney LLP MUNICIPAL ADVISOR: Ehlers and Associates, Inc. BOOK-ENTRY-ONLY:See "Book-Entry-Only System" herein (unless otherwise specified by the purchaser). REPRESENTATIONS No dealer, broker, salesperson or other person has been authorized by the City to give any information or to make any representation other than those contained in this Preliminary Official Statement and, if given or made, such other information or representations must not be relied upon as having been authorized by the City. This Preliminary Official Statement does not constitute an offer to sell or a solicitation of an offer to buy any of the Bonds in any jurisdiction to any person to whom it is unlawful to make such an offer or solicitation in such jurisdiction. This Preliminary Official Statement is not to be construed as a contract with the Syndicate Manager or Syndicate Members. Statements contained herein which involve estimates or matters of opinion are intended solely as such and are not to be construed as representations of fact. Ehlers and Associates, Inc. prepared this Preliminary Official Statement and any addenda thereto relying on information of the City and other sources for which there is reasonable basis for believing the information is accurate and complete. Bond Counsel has not participated in the preparation of this Preliminary Official Statement and is not expressing any opinion as to the completeness or accuracy of the information contained therein. Compensation of Ehlers and Associates, Inc., payable entirely by the City, is contingent upon the delivery of the Bonds. COMPLIANCE WITH S.E.C. RULE 15c2-12 Certain municipal obligations (issued in an aggregate amount over $1,000,000) are subject to Rule 15c2-12 promulgated by the Securities and Exchange Commission pursuant to the Securities Exchange Act of 1934, as amended (the "Rule"). Preliminary Official Statement: This Preliminary Official Statement was prepared for the City for dissemination to potential investors. Its primary purpose is to disclose information regarding the Bonds to prospective underwriters in the interest of receiving competitive proposals in accordance with the sale notice contained herein. Unless an addendum is posted prior to the sale, this Preliminary Official Statement shall be deemed nearly final for purposes of the Rule subject to completion, revision and amendment in a Final Official Statement as defined below. Review Period: This Preliminary Official Statement has been distributed to prospective bidders for review. Comments or requests for the correction of omissions or inaccuracies must be submitted to Ehlers and Associates, Inc. at least two business days prior to the sale. Requests for additional information or corrections in the Preliminary Official Statement received on or before this date will not be considered a qualification of a proposal received from an underwriter. If there are any changes, corrections or additions to the Preliminary Official Statement, interested bidders will be informed by an addendum prior to the sale. Final Official Statement: Copies of the Final Official Statement will be delivered to the underwriter (Syndicate Manager) within seven business days following the proposal acceptance. Continuing Disclosure: Subject to certain exemptions, issues in an aggregate amount over $1,000,000 may be required to comply with provisions of the Rule which require that underwriters obtain from the issuers of municipal securities (or other obligated party) an agreement for the benefit of the owners of the securities to provide continuing disclosure with respect to those securities. This Preliminary Official Statement describes the conditions under which the City is required to comply with the Rule. CLOSING CERTIFICATES Upon delivery of the Bonds, the underwriter (Syndicate Manager) will be furnished with the following items: (1) a certificate of the appropriate officials to the effect that at the time of the sale of the Bonds and all times subsequent thereto up to and including the time of the delivery of the Bonds, this Preliminary Official Statement did not and does not contain any untrue statement of a material fact or omit to state a material fact necessary to make the statements therein, in the light of the circumstances under which they were made, not misleading; (2) a receipt signed by the appropriate officer evidencing payment for the Bonds; (3) a certificate evidencing the due execution of the Bonds, including statements that (a) no litigation of any nature is pending, or to the knowledge of signers, threatened, restraining or enjoining the issuance and delivery of the Bonds, (b) neither the corporate existence or boundaries of the City nor the title of the signers to their respective offices is being contested, and (c) no authority or proceedings for the issuance of the Bonds have been repealed, revoked or rescinded; and (4) a certificate setting forth facts and expectations of the City which indicates that the City does not expect to use the proceeds of the Bonds in a manner that would cause them to be arbitrage bonds within the meaning of Section 148 of the Internal Revenue Code of 1986, as amended, or within the meaning of applicable Treasury Regulations. ii TABLE OF CONTENTS INTRODUCTORY STATEMENT.........................1 THE BONDS..........................................1 GENERAL........................................1 OPTIONAL REDEMPTION..........................2 AUTHORITY; PURPOSE............................2 ESTIMATED SOURCES AND USES..................2 SECURITY.......................................3 RATING..........................................3 CONTINUING DISCLOSURE........................3 LEGAL OPINION..................................4 TAX CONSIDERATIONS...........................4 MUNICIPAL ADVISOR.............................7 MUNICIPAL ADVISOR AFFILIATED COMPANIES.....7 INDEPENDENT AUDITORS.........................7 RISK FACTORS...................................8 VALUATIONS.......................................10 OVERVIEW......................................10 CURRENT PROPERTY VALUATIONS...............11 2021/22 NET TAX CAPACITY BY CLASSIFICATION...12 TREND OF VALUATIONS.........................12 LARGER TAXPAYING PARCELS...................13 DEBT...............................................14 DIRECT DEBT...................................14 SCHEDULES OF BONDED INDEBTEDNESS..........15 DEBT LIMIT.....................................25 OVERLAPPING DEBT.............................26 DEBT RATIOS...................................27 DEBT PAYMENT HISTORY........................27 FUTURE FINANCING.............................27 TAX RATES, LEVIES AND COLLECTIONS...............28 TAX LEVIES AND COLLECTIONS..................28 TAX CAPACITY RATES...........................29 LEVY LIMITS....................................29 THE ISSUER.........................................30 CITY GOVERNMENT.............................30 EMPLOYEES; PENSIONS; UNIONS.................30 POST EMPLOYMENT BENEFITS...................30 LITIGATION.....................................30 MUNICIPAL BANKRUPTCY.......................31 FUNDS ON HAND................................31 ENTERPRISE FUNDS.............................32 SUMMARY GENERAL FUND INFORMATION........34 GENERAL INFORMATION.............................35 LOCATION......................................35 LARGER EMPLOYERS............................35 BUILDING PERMITS..............................36 U.S. CENSUS DATA...............................37 EMPLOYMENT/UNEMPLOYMENT DATA...........37 FINANCIAL STATEMENTS...........................A-1 FORM OF LEGAL OPINION...........................B-1 BOOK-ENTRY-ONLY SYSTEM........................C-1 FORM OF CONTINUING DISCLOSURE COVENANTS (EXCERPTS FROM SALE RESOLUTION)...........D-1 TERMS OF PROPOSAL...............................E-1 iii CITY OF EDINA CITY COUNCIL Term Expires James Hovland Mayor January 2025 Ron Anderson Council Member January 2023 Carolyn Jackson Council Member January 2025 James Pierce Council Member January 2025 Kevin Staunton Council Member January 2023 ADMINISTRATION Scott Neal, City Manager Alisha McAndrews, Director of Finance Andrea Rich, Assistant Finance Director PROFESSIONAL SERVICES Dorsey & Whitney LLP, Bond Counsel, Minneapolis, Minnesota Ehlers and Associates, Inc., Municipal Advisors, Roseville, Minnesota (Other office located in Waukesha, Wisconsin) iv INTRODUCTORY STATEMENT This Preliminary Official Statement contains certain information regarding the City of Edina, Minnesota (the "City") and the issuance of its $17,000,000* General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B (the "Bonds"). Any descriptions or summaries of the Bonds, statutes, or documents included herein are not intended to be complete and are qualified in their entirety by reference to such statutes and documents and the form of the Bonds to be included in the resolution authorizing the issuance and sale of the Bonds ("Award Resolution") to be adopted by the City Council on August 3, 2022. Inquiries may be directed to Ehlers and Associates, Inc. ("Ehlers" or the "Municipal Advisor"), Roseville, Minnesota, (651) 697-8500, the City's municipal advisor. A copy of this Preliminary Official Statement may be downloaded from Ehlers’ web site at www.ehlers-inc.com by connecting to the Bond Sales link and following the directions at the top of the site. THE BONDS GENERAL The Bonds will be dated originally as of August 25, 2022, will be issued in fully registered form in the denomination of $5,000 each, or any integral multiple thereof, and will mature on February 1, 2025. The Bonds will bear interest at a single rate specified in the proposal of the purchaser, payable on the date of maturity to the registered owners of the Bonds appearing of record in the bond register as of the close of business fifteen days prior to the maturity date (whether or not a business day). The rate must be expressed in an integral multiple of 5/100 or 1/8 of 1%. Interest will be computed upon the basis of a 360-day year of twelve 30-day months and will be rounded pursuant to rules of the Municipal Securities Rulemaking Board ("MSRB"). Unless otherwise specified by the purchaser, the Bonds will be registered in the name of Cede & Co., as nominee for The Depository Trust Company, New York, New York ("DTC"). (See "Book-Entry-Only System" herein.) As long as the Bonds are held under the book-entry system, beneficial ownership interests in the Bonds may be acquired in book-entry form only, and all payments of principal of, premium, if any, and interest on the Bonds shall be made through the facilities of DTC and its participants. If the book-entry system is terminated, principal of, premium, if any, and interest on the Bonds shall be payable as provided in the Award Resolution. The City has selected U.S. Bank Trust Company, National Association, St. Paul, Minnesota, to act as paying agent (the "Paying Agent"). The City will pay the charges for Paying Agent services. The City reserves the right to remove the Paying Agent and to appoint a successor. *Preliminary, subject to change. 1 OPTIONAL REDEMPTION At the option of the City, the Bonds maturing on or after February 1, 2025 shall be subject to optional redemption prior to maturity on February 1, 2024 or any date thereafter, at a price of par plus accrued interest to the date of optional redemption. Redemption may be in whole or in part of the Bonds subject to prepayment. If redemption is in part, the selection of the amounts and maturities of the Bonds to be redeemed shall be at the discretion of the City. If only part of the Bonds having a common maturity date are called for redemption, then the City or Paying Agent, if any, will notify DTC of the particular amount of such maturity to be redeemed. DTC will determine by lot the amount of each participant's interest in such maturity to be redeemed and each participant will then select by lot the beneficial ownership interest in such maturity to be redeemed. Notice of redemption shall be sent by mail not more than 60 days and not less than 30 days prior to the date fixed for redemption to the registered owner of each Bond to be redeemed at the address shown on the registration books. AUTHORITY; PURPOSE The Bonds are being issued pursuant to Minnesota Statutes, Sections 475.521 and 475.61, and Chapter 475, as amended, by the City for the purpose of financing the site acquisition and design for the City's Fire Station No. 2 project. Minnesota Statutes, Section 475.521, adopted by the 2003 Minnesota State Legislature and amended in 2005, allows cities and towns to plan for and finance the acquisition and betterment of public lands, buildings, and certain other improvements within the municipality, including financing the construction of city halls, town halls, libraries, public safety, and public works facilities. Annual principal and interest payments on general obligation capital improvement bonds and all outstanding bonds issued under Section 475.521 are limited to .16% of the City’s estimated market value of property in the City. The estimated market value of the property in the City for taxes collectible in 2021 is $13,796,381,100. This results in a maximum annual debt service allowable of $22,074,210 for capital improvement bonds outstanding at any time. ESTIMATED SOURCES AND USES* Sources Par Amount of Bonds $17,000,000 Total Sources $17,000,000 Uses Total Underwriter's Discount (0.500%)$85,000 Costs of Issuance 92,000 Deposit to Capitalized Interest (CIF) Fund 670,083 Deposit to Project Fund 16,152,917 Total Uses $17,000,000 *Preliminary, subject to change. 2 SECURITY The Bonds are general obligations of the City for which its full faith, credit and taxing powers are pledged without limitation as to rate or amount. The principal of and interest on the Bonds are payable from additional temporary bonds or definitive bonds and ad valorem taxes to be levied on all taxable property in the City. In accordance with Minnesota Statutes, the City will levy each year an amount not less than 105% of the debt service requirements on the Bonds. In the event funds on hand for payment of principal and interest are at any time insufficient, the City is required to levy an additional ad valorem tax upon all taxable properties within its boundaries without limit as to rate or amount to make up any deficiency. RATING General obligation debt of the City, with the exception of any outstanding credit enhanced issues, is currently rated "Aaa" by Moody's Investors Service, Inc. ("Moody's") and AAA by S&P Global Ratings ("S&P"). The City has requested a rating on this issue from Moody’s and S&P, and bidders will be notified as to the assigned ratings prior to the sale. Such ratings reflect only the views of such organizations and explanations of the significance of such ratings may be obtained from the respective organizations furnishing the same. Generally, a rating agency bases its rating on the information and materials furnished to it and on investigations, studies and assumptions of its own. There is no assurance that such rating will continue for any given period of time or that it will not be revised downward or withdrawn entirely by such rating agency, if in the judgement of such rating agency circumstances so warrant. Any such downward revision or withdrawal of such rating may have an adverse effect on the market price of the Bonds. Such rating is not to be construed as a recommendation of the rating agency to buy, sell or hold the Bonds, and the rating assigned by the rating agency should be evaluated independently. Except as may be required by the Disclosure Undertaking described under the heading "CONTINUING DISCLOSURE" neither the City nor the underwriter undertake responsibility to bring to the attention of the owner of the Bonds any proposed changes in or withdrawal of such rating or to oppose any such revision or withdrawal. CONTINUING DISCLOSURE In order to assist brokers, dealers, and municipal securities dealers, in connection with their participation in the offering of the Bonds, to comply with Rule 15c2-12 promulgated by the Securities and Exchange Commission, pursuant to the Securities and Exchange Act of 1934, as amended (the "Rule"), the City shall agree to provide certain information to the Municipal Securities Rulemaking Board (MSRB) through its Electronic Municipal Market Access (EMMA) system, or any system that may be prescribed in the future. The Rule was last amended, effective February 27, 2019, to include an expanded list of material events. In the Award Resolution, the City shall covenant for the benefit of holders including beneficial holders, to provide electronically, or in a manner otherwise prescribed, certain financial information annually and to provide notices of the occurrence of certain events enumerated in the Rule (the "Disclosure Undertaking"). The details and terms of the Disclosure Undertaking for the City are set forth in Appendix D. Such Disclosure Undertaking will be in substantially the form attached hereto. A failure by the City to comply with any Disclosure Undertaking will not constitute an event of default on the Bonds. However, such a failure may adversely affect the transferability and liquidity of the Bonds and their market price. 3 In the previous five years, the City believes it has not failed to comply in all material respects with its prior undertakings under the Rule. The City has reviewed its continuing disclosure responsibilities along with any changes to the Rule, to ensure compliance. Ehlers is currently engaged as dissemination agent for the City. LEGAL OPINION An opinion in substantially the form attached hereto as Appendix B will be furnished by Dorsey & Whitney LLP ("Bond Counsel"), Minneapolis, Minnesota, bond counsel to the City. TAX CONSIDERATIONS The following is a summary of certain U.S. federal and Minnesota income tax considerations relating to the purchase, ownership, and disposition of the Bonds. This summary is based on the U.S. Internal Revenue Code of 1986 (the "Code") and the Treasury Regulations promulgated thereunder, judicial decisions, and published rulings and administrative pronouncements of the Internal Revenue Service (the "IRS"), all as of the date hereof and all of which are subject to change, possibly with retroactive effect. Any such change could adversely affect the matters discussed below, including the tax exemption of interest on the Bonds. The City has not sought and will not seek any rulings from the IRS regarding the matters discussed below, and there can be no assurance the IRS or a court will not take a contrary position regarding these matters. Prospective purchasers of Bonds should consult their own tax advisors with respect to applicable federal, state, and local tax rules, and any pending or proposed legislation or regulatory or administrative actions, relating to the Bonds based on their own particular circumstances. This summary is for general information only and is not intended to constitute a complete analysis of all tax considerations relating to the purchase, ownership, and disposition of Bonds. It does not address the application of the alternative minimum tax or the additional tax on net investment income, nor does it address the U.S. federal estate and gift tax or any state, local, or non-U.S. tax consequences except with respect to Minnesota income tax to the extent expressly specified herein. This summary is limited to consequences to U.S. holders that purchase the Bonds for cash at original issue and hold the Bonds as "capital assets" (generally, property held for investment). This discussion does not address all aspects of U.S. federal income or state taxation that may be relevant to particular holders of Bonds in light of their specific circumstances or the tax considerations applicable to holders that may be subject to special income tax rules, such as: holders subject to special tax accounting rules under Section 451(b) of the Code; insurance companies; brokers, dealers, or traders in stocks, securities, or currencies or notional principal contracts; foreign corporations subject to the branch profits tax; holders receiving payments in respect of the Bonds through foreign entities; and S corporations, partnerships, or other pass-through entities or investors therein. For purposes of this discussion, the "issue price" of a maturity of Bonds is the first price at which a substantial amount of Bonds of that maturity is sold for cash to persons other than bond houses, brokers, or similar persons or organizations acting in the capacity of underwriters, placement agents, or wholesalers. Tax-Exempt Interest In the opinion of Dorsey & Whitney LLP, Bond Counsel, based on existing law and assuming the accuracy of certain representations and compliance with certain covenants, interest on the Bonds (i) is excluded from gross income for federal income tax purposes under Section 103 of the Code, (ii) is not an item of tax preference for purposes of the federal alternative minimum tax imposed by Section 55 of the Code, (iii) is excluded from taxable net income of individuals, estates, and trusts for Minnesota income tax purposes, and (iv) is not an item of tax preference for Minnesota alternative minimum tax purposes. Interest on the Bonds is included, however, in net income for purposes of the Minnesota franchise tax imposed on corporations and financial institutions. 4 The Code establishes certain requirements that must be met after the issuance of the Bonds in order that interest on the Bonds be excluded from federal gross income and from Minnesota taxable net income of individuals, estates, and trusts. These requirements include, but are not limited to, provisions regarding the use of Bond proceeds and the facilities financed or refinanced with such proceeds and restrictions on the investment of Bond proceeds and other amounts. The City has made certain representations and has covenanted to comply with certain restrictions, conditions, and requirements designed to ensure interest on the Bonds will not be included in federal gross income. Inaccuracy of these representations or noncompliance with these covenants may cause interest on the Bonds to be included in federal gross income or in Minnesota taxable net income retroactively to their date of issue. Bond Counsel has not independently verified the accuracy of these representations and will not verify the continuing compliance with these covenants. No provision has been made for redemption of or for an increase in the interest rate on the Bonds in the event that interest on the Bonds is included in federal gross income or in Minnesota taxable net income. Original Issue Discount Bonds may be issued with original issue discount ("OID"). A Bond will be treated as issued with OID (a "Discount Bond") if its "stated redemption price at maturity" (i.e., the sum of all amounts payable on the Bond other than payments of qualified stated interest) exceeds its issue price. OID that accrues to a holder of a Discount Bond is excluded from federal gross income and from Minnesota taxable net income of individuals, estates, and trusts to the same extent that stated interest on such Discount Bond would be so excluded. The amount of OID that accrues on a Discount Bond is added to the holder’s federal and Minnesota tax bases. OID is taxable under the Minnesota franchise tax on corporations and financial institutions. OID on a Discount Bond generally accrues pursuant to a constant-yield method that reflects semiannual compounding on dates that are determined by reference to the maturity date of the Discount Bond. The amount of OID that accrues for any particular semiannual accrual period generally is equal to the excess of (1) the product of (a) one-half of the yield on such Discount Bonds (adjusted as necessary for an initial short period) and (b) the adjusted issue price of such Discount Bonds, over (2) the amount of stated interest actually payable. For this purpose, the adjusted issue price is determined by adding to the issue price for such Discount Bonds the OID that is treated as having accrued during all prior accrual periods. If a Discount Bond is sold or otherwise disposed of between compounding dates, then the original issue discount that would have accrued for that accrual period for federal income tax purposes is allocated ratably to the days in that accrual period. If a Discount Bond is purchased for a cost that exceeds the sum of the issue price plus accrued interest and accrued OID, the amount of OID that is deemed to accrue thereafter to the purchaser is reduced by an amount that reflects amortization of such excess over the remaining term of the Discount Bond. If the excess is greater than the amount of remaining OID, the basis reduction rules for amortizable bond premium may result in taxable gain upon sale or other disposition of the Bonds, even if the Bonds are sold, redeemed, or retired for an amount equal to or less than their cost. It is possible under certain state and local income tax laws that original issue discount on a Discount Bond may be taxable in the year of accrual and may be deemed to accrue differently than under federal law. Market Discount If a Bond is purchased for a cost that is less than the Bond's issue price (plus accrued original issue discount, if any), the purchaser will be treated as having purchased the Bond with market discount (unless a statutory de minimis rule applies). Market discount is treated as ordinary income and generally is recognized on the maturity or earlier disposition of the Bond (to the extent that the gain realized does not exceed the accrued market discount on the Bond). 5 Bond Premium A holder that acquires a Bond for an amount in excess of its stated redemption price at maturity generally must, from time to time, reduce the holder’s federal and Minnesota tax bases for the Bond. Premium generally is amortized for federal income tax purposes and Minnesota income and franchise tax purposes on the basis of a bondholder's constant yield to maturity or to certain call dates with semiannual compounding. Accordingly, holders who acquire Bonds at a premium might recognize taxable gain upon sale of the Bonds, even if such Bonds are sold for an amount equal to or less than their original cost. Amortized premium is not deductible for federal income tax purposes or for purposes of the Minnesota income tax applicable to individuals, estates, and trusts. Related Tax Considerations Section 86 of the Code and corresponding provisions of Minnesota law require recipients of certain social security and railroad retirement benefits to take interest on the Bonds into account in determining the taxability of such benefits. Section 265(a) of the Code denies a deduction for interest on indebtedness incurred or continued to purchase or carry the Bonds, and Minnesota law similarly denies a deduction for such interest in the case of individuals, estates, and trusts. In the case of a financial institution, generally, no deduction is allowed under section 265(b) of the Code for that portion of the holder’s interest expense that is allocable to interest on tax-exempt obligations, such as the Bonds, unless the obligations are "qualified tax-exempt obligations." Indebtedness may be allocated to the Bonds for this purpose even though not directly traceable to the purchase of the Bonds. The Bonds are not "qualified tax-exempt obligations" for purposes of Section 265(b)(3) of the Code. The ownership or disposition of, or the accrual or receipt of amounts treated as interest on, the Bonds may affect a holder’s federal, state, or local tax liability in some additional circumstances. The nature and extent of these other tax consequences depends upon the particular tax status of the holder and the holder’s other items of income or deduction. Sale or Other Disposition A holder will generally recognize gain or loss on the sale, exchange, redemption, retirement, or other disposition of a Bond equal to the difference between (i) the amount realized less amounts attributable to any accrued but unpaid stated interest and (ii) the holder’s adjusted tax basis in the Bond. The amount realized includes the cash and the fair market value of any property received by the holder in exchange for the Bond. A holder’s adjusted tax basis in a Bond generally will be equal to the amount that the holder paid for the Bond, increased by any accrued original issue discount with respect to the Bond and reduced by the amount of any amortized bond premium on the Bond. Except to the extent attributable to market discount (which will be taxable as ordinary income to the extent not previously included in income), any gain or loss will be capital gain or loss and will be long-term capital gain or loss if the holder held the Bond for more than one year. Long-term capital gains recognized by certain non-corporate persons, including individuals, generally are taxable at a reduced rate. The deductibility of capital losses is subject to significant limitations. 6 Information Reporting and Backup Withholding Payments of interest on the Bonds (including any allocable bond premium or accrued original issue discount) and proceeds from the sale or other disposition of the Bonds are expected to be reported to the IRS as required under applicable Treasury Regulations. Backup withholding will apply to these payments if the holder fails to provide an accurate taxpayer identification number and certification that it is not subject to backup withholding (generally on an IRS Form W-9) or otherwise fails to comply with the applicable backup withholding requirements. Backup withholding is not an additional tax. Any amounts withheld under the backup withholding rules may be allowed as a refund or a credit against the holder’s U.S. federal income tax liability, provided that the required information is timely furnished to the IRS. Certain holders are exempt from information reporting. Potential holders should consult their own tax advisors regarding qualification for an exemption and the procedures for obtaining such an exemption. MUNICIPAL ADVISOR Ehlers has served as municipal advisor to the City in connection with the issuance of the Bonds. The Municipal Advisor cannot participate in the underwriting of the Bonds. The financial information included in this Preliminary Official Statement has been compiled by the Municipal Advisor. Such information does not purport to be a review, audit or certified forecast of future events and may not conform with accounting principles applicable to compilations of financial information. Ehlers is not a firm of certified public accountants. Ehlers is registered with the Securities and Exchange Commission and the MSRB as a municipal advisor. Ehlers makes no representation, warranty or guarantee regarding the accuracy or completeness of the information in this Preliminary Official Statement, and its assistance in preparing this Preliminary Official Statement should not be construed as a representation that it has independently verified such information. MUNICIPAL ADVISOR AFFILIATED COMPANIES Bond Trust Services Corporation ("BTSC") and Ehlers Investment Partners, LLC ("EIP") are affiliate companies of Ehlers. BTSC is chartered by the State of Minnesota and authorized in Minnesota, Wisconsin, Colorado, and Illinois to transact the business of a limited purpose trust company. BTSC provides paying agent services to debt issuers. EIP is a Registered Investment Advisor with the Securities and Exchange Commission. EIP assists issuers with the investment of bond proceeds or investing other issuer funds. This includes escrow bidding agent services. Issuers, such as the City, have retained or may retain BTSC and/or EIP to provide these services. If hired, BTSC and/or EIP would be retained by the City under an agreement separate from Ehlers. INDEPENDENT AUDITORS The basic financial statements of the City for the fiscal year ended December 31, 2021 have been audited by CliftonLarsonAllen LLP, Minneapolis, Minnesota, independent auditors (the "Auditor"). The report of the Auditor, together with the basic financial statements, component units financial statements, and notes to the financial statements are attached hereto as "APPENDIX A – FINANCIAL STATEMENTS". The Auditor has not been engaged to perform and has not performed, since the date of its report included herein, any procedures on the financial statements addressed in that report. The Auditor also has not performed any procedures relating to this Preliminary Official Statement. 7 RISK FACTORS Following is a description of possible risks to holders of the Bonds without weighting as to probability. This description of risks is not intended to be all-inclusive, and there may be other risks not now perceived or listed here. Taxes: The Bonds are general obligations of the City, the ultimate payment of which rests in the City's ability to levy and collect sufficient taxes to pay debt service. In the event of delayed billing, collection or distribution of property taxes, sufficient funds may not be available to the City in time to pay debt service when due. State Actions: Many elements of local government finance, including the issuance of debt and the levy of property taxes, are controlled by state government. Future actions of the state may affect the overall financial condition of the City, the taxable value of property within the City, and the ability of the City to levy and collect property taxes. Future Changes in Law: Various State and federal laws, regulations and constitutional provisions apply to the City and to the Bonds. The City can give no assurance that there will not be a change in or interpretation of any such applicable laws, regulations and provisions which would have a material effect on the City or the taxing authority of the City. Ratings; Interest Rates: In the future, the City's credit rating may be reduced or withdrawn, or interest rates for this type of obligation may rise generally, either possibility resulting in a reduction in the value of the Bonds for resale prior to maturity. Tax Exemption: If the federal government or the State of Minnesota taxes all or a portion of the interest on municipal obligations, directly or indirectly, or if there is a change in federal or state tax policy, the value of the Bonds may fall for purposes of resale. Noncompliance following the issuance of the Bonds with certain requirements of the Code and covenants of the bond resolution may result in the inclusion of interest on the Bonds in gross income of the recipient for United States income tax purposes or in taxable net income of individuals, estates or trusts for State of Minnesota income tax purposes. No provision has been made for redemption of the Bonds, or for an increase in the interest rate on the Bonds, in the event that interest on the Bonds becomes subject to United States or State of Minnesota income taxation, retroactive to the date of issuance. Continuing Disclosure: A failure by the City to comply with the Disclosure Undertaking for continuing disclosure (see "CONTINUING DISCLOSURE") will not constitute an event of default on the Bonds. Any such failure must be reported in accordance with the Rule and must be considered by any broker, dealer, or municipal securities dealer before recommending the purchase or sale of the Bonds in the secondary market. Such a failure may adversely affect the transferability and liquidity of the Bonds and their market price. State Economy; State Aids: State of Minnesota cash flow problems could affect local governments and possibly increase property taxes. Book-Entry-Only System: The timely credit of payments for principal and interest on the Bonds to the accounts of the Beneficial Owners of the Bonds may be delayed due to the customary practices, standing instructions or for other unknown reasons by DTC participants or indirect participants. Since the notice of redemption or other notices to holders of these obligations will be delivered by the City to DTC only, there may be a delay or failure by DTC, DTC participants or indirect participants to notify the Beneficial Owners of the Bonds. Economy: A combination of economic, climatic, political or civil disruptions or terrorist actions outside of the control of the City, including loss of major taxpayers or major employers, could affect the local economy and result in reduced tax collections and/or increased demands upon local government. Real or perceived threats to the financial stability of the City may have an adverse effect on the value of the Bonds in the secondary market. 8 Secondary Market for the Bonds: No assurance can be given that a secondary market will develop for the purchase and sale of the Bonds or, if a secondary market exists, that such Bonds can be sold for any particular price. The underwriters are not obligated to engage in secondary market trading or to repurchase any of the Bonds at the request of the owners thereof. Prices of the Bonds as traded in the secondary market are subject to adjustment upward and downward in response to changes in the credit markets and other prevailing circumstances. No guarantee exists as to the future market value of the Bonds. Such market value could be substantially different from the original purchase price. Bankruptcy: The rights and remedies of the holders may be limited by and are subject to the provisions of federal bankruptcy laws, to other laws, or equitable principles that may affect the enforcement of creditors’ rights, to the exercise of judicial discretion in appropriate cases and to limitations on legal remedies against local governments. The opinion of Bond Counsel to be delivered with respect to the Bonds will be similarly qualified. Cybersecurity: The City is dependent on electronic information technology systems to deliver services. These systems may contain sensitive information or support critical operational functions which may have value for unauthorized purposes. As a result, the electronic systems and networks may be targets of cyberattack. There can be no assurance that the City will not experience an information technology breach or attack with financial consequences that could have a material adverse impact. Impact of the Spread of COVID-19: In late 2019, a novel strain of coronavirus (COVID-19) emerged in Wuhan, Hubei Province, China. COVID-19 has spread throughout the world, including to the United States, resulting in the World Health Organization proclaiming COVID-19 to be a pandemic and the declaration of a national emergency. In response to the spread of COVID-19, the United States government, state governments, local governments and private industries have taken measures to limit social interactions in an effort to limit the spread of COVID-19. The effects of the spread of COVID-19 and the government and private responses to the spread continue to rapidly evolve. COVID-19 has caused significant disruptions to the global, national and State economy. The extent to which the coronavirus impacts the City and its financial condition will depend on future developments, which are highly uncertain and cannot be predicted by the City, including the duration of the outbreak and measures taken to address the outbreak. On March 13, 2020, Minnesota Governor Tim Walz signed Emergency Executive Order 20-01 and declared a peacetime emergency. In subsequent executive orders, the Governor extended the peacetime emergency by 30 days. On May 14, 2021, the Governor signed Executive Order 21-23 to end the statewide mask requirement and align with new Centers for Disease Control and Prevention (CDC) guidance on face coverings. The Minnesota Legislature ended the peacetime emergency declaration on July 1, 2021. The Coronavirus Aid, Relief, and Economic Security Act (the "CARES Act") provides for federal payments from the Coronavirus Relief Fund to the State for the discrete purpose of covering expenses directly incurred as a result of COVID-19 between March 1 and December 30, 2020. On March 11, 2021, President Biden signed the American Rescue Plan Act of 2021, which provides local governments an additional $130.2 billion through the Coronavirus Local Fiscal Recovery Fund. These funds can be used to mitigate increased expenditures, lost revenue and economic hardship related to the COVID-19 pandemic. The foregoing is intended only as a summary of certain risk factors attendant to an investment in the Bonds. In order for potential investors to identify risk factors and make an informed investment decision, potential investors should be thoroughly familiar with this entire Preliminary Official Statement and the Appendices hereto. 9 VALUATIONS OVERVIEW All non-exempt property is subject to taxation by local taxing districts. Exempt real property includes Indian lands, public property, and educational, religious and charitable institutions. Most personal property is exempt from taxation (except investor-owned utility mains, generating plants, etc.). The valuation of property in Minnesota consists of three elements. (1) The estimated market value is set by city or county assessors. Not less than 20% of all real properties are to be appraised by local assessors each year. (2) The taxable market value is the estimated market value adjusted by all legislative exclusions. (3) The tax capacity (taxable) value of property is determined by class rates set by the State Legislature. The tax capacity rate varies according to the classification of the property. Tax capacity represents a percent of taxable market value. The property tax rate for a local taxing jurisdiction is determined by dividing the total tax capacity or market value of property within the jurisdiction into the dollars to be raised from the levy. State law determines whether a levy is spread on tax capacity or market value. Major classifications and the percentages by which tax capacity is determined are: Type of Property 2019/20 2020/21 2021/22 Residential homestead1 First $500,000 - 1.00% Over $500,000 - 1.25% First $500,000 - 1.00% Over $500,000 - 1.25% First $500,000 - 1.00% Over $500,000 - 1.25% Agricultural homestead1 First $500,000 HGA - 1.00% Over $500,000 HGA - 1.25% First $1,880,000 - 0.50% 2 Over $1,880,000 - 1.00% 2 First $500,000 HGA - 1.00% Over $500,000 HGA - 1.25% First $1,900,000 - 0.50% 2 Over $1,900,000 - 1.00% 2 First $500,000 HGA - 1.00% Over $500,000 HGA - 1.25% First $1,890,000 - 0.50% 2 Over $1,890,000 - 1.00% 2 Agricultural non-homestead Land - 1.00% 2 Land - 1.00% 2 Land - 1.00% 2 Seasonal recreational residential First $500,000 - 1.00% 3 Over $500,000 - 1.25% 3 First $500,000 - 1.00% 3 Over $500,000 - 1.25% 3 First $500,000 - 1.00% 3 Over $500,000 - 1.25% 3 Residential non-homestead:1 unit - 1st $500,000 - 1.00% Over $500,000 - 1.25% 2-3 units - 1.25% 4 or more - 1.25% Small City4 - 1.25% Affordable Rental: First $150,000 - .75% Over $150,000 - .25% 1 unit - 1st $500,000 - 1.00% Over $500,000 - 1.25% 2-3 units - 1.25% 4 or more - 1.25% Small City 4 - 1.25% Affordable Rental: First $162,000 - .75% Over $162,000 - .25% 1 unit - 1st $500,000 - 1.00% Over $500,000 - 1.25% 2-3 units - 1.25% 4 or more - 1.25% Small City 4 - 1.25% Affordable Rental: First $174,000 - .75% Over $174,000 - .25% Industrial/Commercial/Utility5 First $150,000 - 1.50% Over $150,000 - 2.00% First $150,000 - 1.50% Over $150,000 - 2.00% First $100,000 - 1.50% Over $150,000 - 2.00% 1 A residential property qualifies as "homestead" if it is occupied by the owner or a relative of the owner on the assessment date. 2 Applies to land and buildings. Exempt from referendum market value tax. 3 Exempt from referendum market value tax. 4 Cities of 5,000 population or less and located entirely outside the seven-county metropolitan area and the adjacent nine-county area and whose boundaries are 15 miles or more from the boundaries of a Minnesota city with a population of over 5,000. 5 The estimated market value of utility property is determined by the Minnesota Department of Revenue. 10 CURRENT PROPERTY VALUATIONS 2021/22 Economic Market Value $15,049,883,9011 2021/22 Assessor's Estimated Market Value 2021/22 Net Tax Capacity Real Estate $13,760,758,800 $169,227,375 Personal Property 35,622,300 700,853 Total Valuation $13,796,381,100 $169,928,228 Less:Captured Tax Increment Tax Capacity2 (1,861,452) Fiscal Disparities Contribution3 (16,575,905) Taxable Net Tax Capacity $151,490,871 Plus:Fiscal Disparities Distribution3 4,507,212 Adjusted Taxable Net Tax Capacity $155,998,083 1 According to the Minnesota Department of Revenue, the Assessor's Estimated Market Value (the "AEMV") for the City is about 92.57% of the actual selling prices of property most recently sold in the City. The sales ratio was calculated by comparing the selling prices with the AEMV. Dividing the AEMV of real estate by the sales ratio and adding the AEMV of personal property and utility, railroads and minerals, if any, results in an Economic Market Value ("EMV") for the City of $15,049,883,901. 2 The captured tax increment value shown above represents the captured net tax capacity of tax increment financing districts in the City. 3 Each community in the seven-county metropolitan area contributes 40% of the growth in its commercial- industrial property tax base since 1972 to an area pool which is then distributed among the municipalities on the basis of population, and fiscal capacity indicated market value as determined by the Minnesota Department of Revenue. Each governmental unit makes a contribution and receives a distribution--sometimes gaining and sometimes contributing net tax capacity for tax purposes. 11 2021/22 NET TAX CAPACITY BY CLASSIFICATION 2021/22 Net Tax Capacity Percent of Total Net Tax Capacity Residential homestead $109,615,643 64.507% Commercial/industrial 43,477,956 25.586% Public utility 94,856 0.056% Railroad operating property 152,252 0.090% Non-homestead residential 15,833,570 9.318% Commercial & residential seasonal/rec.7,727 0.005% Other 45,371 0.027% Personal property 700,853 0.412% Total $169,928,228 100.000% TREND OF VALUATIONS Levy Year Assessor's Estimated Market Value Assessor's Taxable Market Value Net Tax Capacity1 Adjusted Taxable Net Tax Capacity2 Percent Increase/Decrease in Estimated Market Value 2017/18 $11,655,317,800 $11,547,519,732 $141,934,212 $128,452,728 6.90% 2018/19 12,370,204,900 12,271,672,648 151,279,391 136,082,956 6.13% 2019/20 12,879,164,400 12,785,797,501 157,910,360 141,311,302 4.11% 2020/21 13,344,357,600 13,255,470,961 164,716,554 145,322,698 3.61% 2021/22 13,796,381,100 13,713,196,631 169,928,228 155,998,083 3.39% 1 Net Tax Capacity is before fiscal disparities adjustments and includes tax increment values. 2 Adjusted Taxable Net Tax Capacity is after fiscal disparities adjustments and does not include tax increment values. 12 LARGER TAXPAYING PARCELS1 Taxpayer Type of Property 2021/22 Net Tax Capacity Percent of City's Total Net Tax Capacity Southdale Center LLC Commercial $2,710,250 1.59% Galleria Shopping Center Commercial 2,390,690 1.41% HSRE Minnesota Edina SMC LLC Commercial 1,495,926 0.88% Southdale Office Partnership Commercial 1,009,858 0.59% LMC Edina Holdings LLC Apartment 922,383 0.54% Bel Loden I LLC Apartment 837,969 0.49% Centennial Lakes V LLC Commercial 797,170 0.47% Centennial Lakes IV LLC Commercial 785,224 0.46% One Southdale Place LLC Apartment 749,796 0.44% 7700 France Avenue LLC Commercial 700,760 0.41% Total $12,400,026 7.30% City's Total 2021/22 Net Tax Capacity $169,928,228 Source:Current Property Valuations, Net Tax Capacity by Classification, Trend of Valuations and Larger Taxpaying Parcels have been furnished by Hennepin County. 1 Hennepin County has provided only the ten largest taxpaying parcels which appear on the tax rolls of the County, and therefore the information stated above may not be reflective of the entire valuation of all parcels and may not include all classifications of property. 13 DEBT DIRECT DEBT1 General Obligation Debt (see schedules following) Total G.O. debt secured by municipal revenues $10,308,000 Total G.O. debt secured by special assessments and taxes 26,350,000 Total G.O. debt secured by state aids 10,465,000 Total G.O. debt secured by tax increment revenues 7,545,000 Total G.O. debt secured by taxes 13,065,000 Total G.O. debt secured by utility revenues 37,667,000 Total General Obligation Debt $105,400,000 Temporary General Obligation Debt Issue Date Name of Issue Final Maturity Principal Outstanding 8/25/22 G.O. Temporary CIP Bonds, Series 2022B (includes the Bonds)*2/1/25 $17,000,000 Non-General Obligation Debt (see schedule following) Total non-general obligation debt paid by annual appropriation2 (Edina Housing and Redevelopment Authority (HRA))$12,930,000 *Preliminary, subject to change. 1 Outstanding debt is as of the dated date of the Bonds. 2 Non-general obligation debt has not been included in the debt ratios. 14 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by Municipal Revenues(As of 08/25/2022)327890 329050329671 332216331241 334060340261 351750DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding% PaidCalendar Year Ending2023135,000 40,319 470,000 194,700 134,000 20,790 200,000 58,300 939,000 314,109 1,253,109 9,369,000 9.11%20232024140,000 36,194 485,000 175,600 137,000 18,100 210,000 52,150 972,000 282,044 1,254,044 8,397,000 18.54%20242025145,000 31,919 510,000 155,700 139,000 15,350 215,000 45,775 1,009,000 248,744 1,257,744 7,388,000 28.33%20252026150,000 27,494 530,000 134,900 142,000 12,550 225,000 39,175 1,047,000 214,119 1,261,119 6,341,000 38.48%20262027155,000 22,919 550,000 113,300 145,000 9,700 225,000 32,425 1,075,000 178,344 1,253,344 5,266,000 48.91%20272028160,000 18,194 470,000 92,900 148,000 6,780 235,000 25,525 1,013,000 143,399 1,156,399 4,253,000 58.74%20282029165,000 13,319 490,000 73,700 151,000 3,810 240,000 18,400 1,046,000 109,229 1,155,229 3,207,000 68.89%20292030165,000 8,266 510,000 56,250 77,000 770 160,000 12,400 912,000 77,686 989,686 2,295,000 77.74%20302031175,000 2,844 525,000 40,725 165,000 8,350 865,000 51,919 916,919 1,430,000 86.13%20312032540,000 24,750 165,000 5,050 705,000 29,800 734,800 725,000 92.97%20322033555,000 8,325 170,000 1,700 725,000 10,025 735,025 0 100.00%20331,390,000 201,466 5,635,000 1,070,850 1,073,000 87,850 2,210,000 299,250 10,308,000 1,659,416 11,967,4161)The City has pledged the net revenues from the municipal golf courses, ice arena, swimming pool and liquor stores for these Bonds.Recreational Revenue Refunding Bonds 1)Series 2021C12/16/2021$2,210,00002/01Recreational Revenue Refunding Bonds 1)Series 2017D12/20/2017$1,640,00002/01 & 08/01Recreational Revenue Bonds 1)Series 2017B06/29/2017$7,425,00002/01G.O. Bonds 1)Series 2015B07/09/2015$2,140,00002/0115 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by Special Assessments and Taxes(As of 08/25/2022)37856338245327889 329051328714 330486329388 332212331623 334804DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Principal Interest2023370,0005,550 510,000 213,725 245,000 78,875 115,000 53,000 125,000 61,9192024535,000 192,825 250,000 71,450 120,000 48,300 130,000 58,0942025550,000 173,875 255,000 65,150 125,000 43,400 130,000 53,5442026565,000 157,150 260,000 59,675 130,000 38,300 135,000 48,2442027585,000 139,900 270,000 53,375 135,000 33,675 145,000 42,6442028605,000 121,294 275,000 46,563 140,000 29,550 150,000 37,4942029620,000 101,388 280,000 39,275 140,000 25,350 155,000 32,9192030640,000 80,913 290,000 31,438 145,000 21,075 155,000 28,2692031660,000 58,963 295,000 23,025 150,000 16,650 160,000 23,5442032685,000 35,425 305,000 14,025 155,000 12,075 165,000 18,6692033150,000 20,813 315,0004,725 160,0007,350 170,000 13,6442034155,000 15,281165,0002,475 175,0008,3592035160,0009,375180,0002,8132036170,0003,188203720382039370,0005,550 6,590,000 1,324,113 3,040,000 487,575 1,680,000 331,200 1,975,000 430,1531) This represents the $3,320,000 Assessed Improvement Projects portion of the $14,550,000 General Obligation Bonds, Series 2011A.This portion will be paid solely from special assessments and no tax levy.2) This represents the $9,040,000 Improvement and PIR portions of the $14,275,000 General Obligation Bonds, Series 2015A.This portion will be paid solely from special assessments and no tax levy.3)This represents the $3,940,000 Permanent Improvement Revolving Fund portion of the $16,350,000 General Obligation Bonds, Series 2016A.This portion will be paid solely from special assessments and no tax levy.4)This represents the $1,995,000 Permanent Improvement Revolving Fund portion of the $8,590,000 General Obligation Bonds, Series 2017A.This portion will be paid solely from special assessments and no tax levy.5) This represents the $2,210,000 Permanent Improvement Revolving Fund portion of the $5,515,000 General Obligation Bonds, Series 2018A.This portion will be paid solely from special assessments and no tax levy.‐‐Continued on next pagePermanent Imp. Revolving Fund Bonds 5) Series 2018A06/27/2018$2,210,00002/01Permanent Imp. Revolving Fund Bonds 4) Series 2017A06/29/2017$1,995,00002/01Permanent Imp. Revolving Fund Bonds 3)Series 2016A07/06/2016$3,940,00002/01Improvement Bonds 2)Series 2015A07/09/2015$9,040,00002/01Improvement Bonds 1) Series 2011A10/27/2011$3,320,00002/0116 City of Edina, MinnesotaSchedule of Bonded Indebtedness continuedGeneral Obligation Debt Secured by Special Assessments and Taxes(As of 08/25/2022)333376 338493338693 346692339288 348500339663 350056340260 351749DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Principal Interest2023110,000 80,85020,000 10,100 197,000 13,7450 181,150 125,000 60,8752024115,000 75,22520,0009,300 199,000 11,592 280,000 175,550 145,000 54,1252025120,000 69,35020,0008,500 200,0009,418 290,000 164,150 150,000 46,7502026125,000 63,22525,0007,600 203,0007,232 300,000 152,350 155,000 39,1252027135,000 56,72525,0006,600 200,0005,030 315,000 140,050 165,000 31,1252028140,000 49,85025,0005,600 206,0002,834 325,000 127,250 170,000 22,7502029145,000 42,72525,0004,850 105,000572 340,000 113,950 180,000 14,0002030155,000 35,22525,0004,350350,000 100,150 190,0004,7502031160,000 28,95025,0003,850365,000 85,8502032165,000 24,07530,0003,300380,000 72,8502033170,000 19,05030,0002,700395,000 61,2252034175,000 13,87530,0002,100405,000 49,2252035185,0008,47530,0001,500415,000 36,9252036190,0002,85030,000900430,000 24,250203730,000300440,000 13,4002038450,0004,50020392,090,000 570,450 390,000 71,550 1,310,000 50,423 5,480,000 1,502,825 1,280,000 273,5006)This represents the $2,455,000 Permanent Improvement Revolving Fund portion of the $12,740,000 General Obligation Bonds, Series 2019A.This portion will be paid solely from special assessments and no tax levy.7)This represents the $390,000 Permanent Imp. Revolving Fund portion of the $5,220,000 General Obligation Bonds, Series 2020A.8)This represents the $1,601,000 Improvement Refunding portion of the $3,015,000 General Obligation Refunding Bonds, Series 2020B.This portion will be paid solely from special assessments, with no annual tax levy.9)This represents the $5,480,000 Permanent Improvement Revolving Fund portion of the $13,025,000 General Obligation Bonds, Series 2021A.This portion will be paid solely from special assessments, with no annual tax levy.10)This represents the $1,287,000 Series 2013A Permanent Improvement Revolving Fund Refunding portion of the $3,795,000 General Obligation Refunding Bonds, Series 2021B. This portion will be paid solely from special assessments and no tax levy.‐‐Continued on next pagePermanent Imp. Revolving Fund Ref Bonds 10)Series 2021B12/16/2021$1,280,00002/01Permanent Imp. Revolving Fund Bonds 9)Series 2021A06/24/2021$5,480,00002/01Improvement Refunding Bonds 8) Series 2020B12/30/2020$1,601,00002/01 & 08/01Permanent Imp. Revolving Fund Bonds 7)Series 2020A06/25/2020$390,00002/01Permanent Imp. Revolving Fund Bonds 6)Series 2019A06/13/2019$2,195,00002/0117 City of Edina, MinnesotaSchedule of Bonded Indebtedness continuedGeneral Obligation Debt Secured by Special Assessments and Taxes(As of 08/25/2022)340887 353388DatedAmountMaturityCalendar Year Ending Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding % PaidCalendar Year Ending20230 112,315 1,817,000 872,103 2,689,103 24,533,000 6.90%202320240 107,250 1,794,000 803,711 2,597,711 22,739,000 13.70%20242025100,000 104,750 1,940,000 738,886 2,678,886 20,799,000 21.07%20252026105,000 99,625 2,003,000 672,526 2,675,526 18,796,000 28.67%20262027110,000 94,250 2,085,000 603,374 2,688,374 16,711,000 36.58%20272028115,000 88,625 2,151,000 531,809 2,682,809 14,560,000 44.74%20282029120,000 82,750 2,110,000 457,779 2,567,779 12,450,000 52.75%20292030125,000 76,625 2,075,000 382,794 2,457,794 10,375,000 60.63%20302031135,000 70,125 1,950,000 310,956 2,260,956 8,425,000 68.03%20312032140,000 63,250 2,025,000 243,669 2,268,669 6,400,000 75.71%20322033145,000 56,125 1,535,000 185,631 1,720,631 4,865,000 81.54%20332034155,000 48,625 1,260,000 139,941 1,399,941 3,605,000 86.32%20342035160,000 40,750 1,130,000 99,838 1,229,838 2,475,000 90.61%20352036170,000 32,500 990,000 63,688 1,053,688 1,485,000 94.36%20362037180,000 23,750 650,000 37,450 687,450 835,000 96.83%20372038190,000 14,500 640,000 19,000 659,000 195,000 99.26%20382039195,000 4,875 195,000 4,875 199,875 0 100.00%20392,145,000 1,120,690 26,350,000 6,168,029 32,518,02911) This represents the $2,145,000 Permanent Improvement Revolving Fund portion of the $26,305,000 General Obligation Bonds, Series 2022A.This portion will be paid solely from special assessments and no tax levy.Permanent Imp. Revolving Fund Bonds 11)Series 2022A07/14/2022$2,145,00002/0118 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by State Aids(As of 08/25/2022)340887 353389DatedAmountMaturityCalendar Year Ending Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding % PaidCalendar Year Ending20230 547,9590 547,959 547,959 10,465,000 .00%20232024485,000 511,125485,000 511,125 996,125 9,980,000 4.63%20242025510,000 486,250510,000 486,250 996,250 9,470,000 9.51%20252026535,000 460,125535,000 460,125 995,125 8,935,000 14.62%20262027560,000 432,750560,000 432,750 992,750 8,375,000 19.97%20272028590,000 404,000590,000 404,000 994,000 7,785,000 25.61%20282029620,000 373,750620,000 373,750 993,750 7,165,000 31.53%20292030650,000 342,000650,000 342,000 992,000 6,515,000 37.74%20302031685,000 308,625685,000 308,625 993,625 5,830,000 44.29%20312032715,000 273,625715,000 273,625 988,625 5,115,000 51.12%20322033750,000 237,000750,000 237,000 987,000 4,365,000 58.29%20332034790,000 198,500790,000 198,500 988,500 3,575,000 65.84%20342035830,000 158,000830,000 158,000 988,000 2,745,000 73.77%20352036870,000 115,500870,000 115,500 985,500 1,875,000 82.08%20362037915,000 70,875915,000 70,875 985,875 960,000 90.83%20372038960,000 24,000960,000 24,000 984,0000 100.00%203810,465,000 4,944,084 10,465,000 4,944,084 15,409,0841) This represents the $10,465,000 State Aid portion of the $26,305,000 General Obligation Bonds, Series 2022A.State Aid Bonds 1)Series 2022A07/14/2022$10,465,00002/0119 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by Tax Increment Revenues(As of 08/25/2022)339663 350057DatedAmountMaturityCalendar Year Ending Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding % PaidCalendar Year Ending2023250,000 217,250250,000 217,250 467,250 7,295,000 3.31%20232024260,000 207,050260,000 207,050 467,050 7,035,000 6.76%20242025270,000 196,450 270,000 196,450 466,450 6,765,000 10.34%20252026280,000 185,450 280,000 185,450 465,450 6,485,000 14.05%20262027290,000 174,050 290,000 174,050 464,050 6,195,000 17.89%20272028300,000 162,250 300,000 162,250 462,250 5,895,000 21.87%20282029315,000 149,950 315,000 149,950 464,950 5,580,000 26.04%20292030325,000 137,150 325,000 137,150 462,150 5,255,000 30.35%20302031340,000 123,850 340,000 123,850 463,850 4,915,000 34.86%20312032355,000 111,725 355,000 111,725 466,725 4,560,000 39.56%20322033365,000 100,925 365,000 100,925 465,925 4,195,000 44.40%20332034375,000 89,825 375,000 89,825 464,825 3,820,000 49.37%20342035385,000 78,425 385,000 78,425 463,425 3,435,000 54.47%20352036395,000 66,725 395,000 66,725 461,725 3,040,000 59.71%20362037410,000 56,700 410,000 56,700 466,700 2,630,000 65.14%20372038415,000 48,450 415,000 48,450 463,450 2,215,000 70.64%20382039425,000 40,050 425,000 40,050 465,050 1,790,000 76.28%20392040435,000 31,450 435,000 31,450 466,450 1,355,000 82.04%20402041445,000 22,650 445,000 22,650 467,650 910,000 87.94%20412042450,000 13,700 450,000 13,700 463,700 460,000 93.90%20422043460,000 4,600 460,000 4,600 464,600 0 100.00%20437,545,000 2,218,675 7,545,000 2,218,675 9,763,6751) This represents the $7,545,000 Tax Increment Revenue portion of the $13,025,000 General Obligation Bonds, Series 2021A.Tax Increment Revenue Bonds 1)Series 2021A06/24/2021$7,545,00002/0120 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by Taxes(As of 08/25/2022)328714 330520331114 333959333376 338497340260 351748DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding% PaidCalendar Year Ending2023330,000 48,750 785,000 178,150 280,000 107,25085,000 123,625 1,480,000 457,775 1,937,775 11,585,000 11.33%20232024340,000 38,700 815,000 146,150 295,000 92,875 110,000 118,750 1,560,000 396,475 1,956,475 10,025,000 23.27%20242025350,000 30,100 850,000 112,850 310,000 77,750 340,000 107,500 1,850,000 328,200 2,178,200 8,175,000 37.43%20252026360,000 22,550 885,000 78,150 325,000 61,875 360,000 90,000 1,930,000 252,575 2,182,575 6,245,000 52.20%20262027365,000 13,938 920,000 51,020 340,000 45,250 375,000 71,625 2,000,000 181,833 2,181,833 4,245,000 67.51%20272028375,0004,688 935,000 31,539 360,000 27,750 395,000 52,375 2,065,000 116,351 2,181,351 2,180,000 83.31%20282029955,000 10,744 375,0009,375 415,000 32,125 1,745,000 52,244 1,797,244 435,000 96.67%20292030435,000 10,875 435,000 10,875 445,8750 100.00%20302,120,000 158,725 6,145,000 608,603 2,285,000 422,125 2,515,000 606,875 13,065,000 1,796,328 14,861,3281)This represents the $3,635,000 Series 2007A Refunding portion of the $16,350,000 General Obligation Bonds, Series 2016A.2)This represents the $3,300,000 Equipment Certificates portion of the $12,740,000 General Obligation Bonds, Series 2019A.3)This represents the $2,515,000 Series 2013A Capital Improvement Refunding portion of the $3,795,000 General Obligation Refunding Bonds, Series 2021B.Capital Improvement Plan Refunding Bonds 3)Series 2021B12/16/2021$2,515,00002/01Equipment Certificates 2)Series 2019A06/13/2019$2,805,00002/01Capital Improvement Plan Refunding BondsSeries 2017C12/14/2017$8,955,00002/01Capital Improvement Plan Refunding Bonds 1)Series 2016A07/06/2016$3,635,00002/0121 City of Edina, MinnesotaSchedule of Bonded IndebtednessGeneral Obligation Debt Secured by Utility Revenues(As of 08/25/2022)327228 327678327889 329052328714 330483329388 332213331623 334805DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Principal Interest2023605,000 27,975 550,000 51,300 895,000 105,888 645,000 142,200 315,000 78,5252024630,0009,450 565,000 29,000 915,000 78,738 665,000 116,000 325,000 68,9252025590,0008,850 940,000 55,613 695,000 88,800 330,000 57,4502026965,000 35,356 725,000 60,400 345,000 43,9502027980,000 12,250 750,000 34,650 360,000 29,8502028780,000 11,700 370,000 17,1002029385,0005,7752030203120322033203420352036203720381,235,000 37,425 1,705,000 89,150 4,695,000 287,844 4,260,000 453,750 2,430,000 301,5751)This represents the $5,235,000 Utility Improvement portions of the $14,275,000 General Obligation Bonds, Series 2015A.2)This represents the $8,775,000 Utility Revenue portions of the $16,350,000 General Obligation Bonds, Series 2016A.3)This represents the $6,595,000 Utility Revenue portions of the $8,590,000 General Obligation Bonds, Series 2017A.4)This represents the $3,305,000 Utility Revenue portions of the $5,515,000 General Obligation Bonds, Series 2018A.‐‐Continued on next pageUtility Revenue Bonds 4)Series 2018A06/27/2018$3,305,00002/01Utility Revenue Bonds 3)Series 2017A06/29/2017$6,595,00002/01Utility Revenue Bonds 2)Series 2016A07/06/2016$8,775,00002/01Utility Revenue Bonds 1)Series 2015A07/09/2015$5,235,00002/01Utility Revenue BondsSeries 2014A07/15/2014$5,680,00002/0122 City of Edina, MinnesotaSchedule of Bonded Indebtedness continuedGeneral Obligation Debt Secured by Utility Revenues(As of 08/25/2022)333376 338494338693 346693339288 348497340887 353390DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Principal Interest Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding % PaidCalendar Year Ending2023505,000 230,625 420,000 135,900 357,000 1,946 0 717,085 4,292,000 1,491,444 5,783,444 33,375,000 11.39%20232024535,000 204,625 435,000 118,800 665,000 668,125 4,735,000 1,293,663 6,028,663 28,640,000 23.97%20242025565,000 177,125 455,000 101,000 700,000 634,000 4,275,000 1,122,838 5,397,838 24,365,000 35.31%20252026590,000 148,250 475,000 82,400 730,000 598,250 3,830,000 968,606 4,798,606 20,535,000 45.48%20262027620,000 118,000 490,000 63,100 770,000 560,750 3,970,000 818,600 4,788,600 16,565,000 56.02%20272028650,000 86,250 515,000 43,000 805,000 521,375 3,120,000 679,425 3,799,425 13,445,000 64.31%20282029685,000 52,875 535,000 27,350 850,000 480,000 2,455,000 566,000 3,021,000 10,990,000 70.82%20292030715,000 17,875 545,000 16,550 890,000 436,500 2,150,000 470,925 2,620,925 8,840,000 76.53%20302031555,000 5,550 935,000 390,875 1,490,000 396,425 1,886,425 7,350,000 80.49%20312032980,000 343,000 980,000 343,000 1,323,000 6,370,000 83.09%203220331,030,000 292,750 1,030,000 292,750 1,322,750 5,340,000 85.82%20332034965,000 242,875 965,000 242,875 1,207,875 4,375,000 88.39%203420351,015,000 193,375 1,015,000 193,375 1,208,375 3,360,000 91.08%203520361,065,000 141,375 1,065,000 141,375 1,206,375 2,295,000 93.91%203620371,120,000 86,750 1,120,000 86,750 1,206,750 1,175,000 96.88%203720381,175,000 29,375 1,175,000 29,375 1,204,375 0 100.00%20384,865,000 1,035,625 4,425,000 593,650 357,000 1,946 13,695,000 6,336,460 37,667,000 9,137,425 46,804,4255)This represents the $6,985,000 Water, Sanitary Sewer and Storm Sewer Utility portions of the $12,740,000 General Obligation Bonds, Series 2019A.6)This represents the $4,830,000 Water, Sanitary Sewer and Storm Sewer Revenue portions of the $5,220,000 General Obligation Bonds, Series 2020A.7)This represents the $1,414,000 Utility Revenue portion of the $3,015,000 General Obligation Refunding Bonds, Series 2020B.8)This represents the $13,695,000 Storm Sewer and Watermain portions of the $26,305,000 General Obligation Bonds, Series 2022A.Utility Revenue Bonds 8)Series 2022A07/14/2022$13,695,00002/01Utility Revenue Refunding Bonds 7)Series 2020B12/30/2020$1,414,00002/01 & 08/01Utility Revenue Bonds 6)Series 2020A06/25/2020$4,830,00002/01Utility Revenue Bonds 5)Series 2019A06/13/2019$5,815,00002/0123 Edina Housing and Redevelopment Authority, MinnesotaSchedule of Bonded IndebtednessNon‐General Obligation Debt Secured by Annual Appropriation(As of 08/25/2022)327229 327685327891 329049DatedAmountMaturityCalendar Year Ending Principal Interest Principal Interest Total Principal Total Interest Total P & IPrincipal Outstanding % PaidCalendar Year Ending2022000 19,2630 19,263 19,263 12,930,000 .00%20222023735,000 366,694335,000 33,500 1,070,000 400,194 1,470,194 11,860,000 8.28%20232024755,000 344,344345,000 23,300 1,100,000 367,644 1,467,644 10,760,000 16.78%20242025780,000 321,319355,000 13,688 1,135,000 335,006 1,470,006 9,625,000 25.56%20252026800,000 297,619370,0004,625 1,170,000 302,244 1,472,244 8,455,000 34.61%20262027825,000 273,244825,000 273,244 1,098,244 7,630,000 40.99%20272028850,000 247,588850,000 247,588 1,097,588 6,780,000 47.56%20282029875,000 220,088875,000 220,088 1,095,088 5,905,000 54.33%20292030905,000 191,163905,000 191,163 1,096,163 5,000,000 61.33%20302031935,000 160,678935,000 160,678 1,095,678 4,065,000 68.56%20312032965,000 128,013965,000 128,013 1,093,013 3,100,000 76.02%203220331,000,00093,6251,000,00093,625 1,093,625 2,100,000 83.76%203320341,030,00057,4561,030,00057,456 1,087,456 1,070,000 91.72%203420351,070,00019,3941,070,00019,394 1,089,3940 100.00%203511,525,000 2,721,222 1,405,00094,375 12,930,000 2,815,597 15,745,597Public Project Revenue Refunding BondsSeries 2015A07/09/2015$3,490,00005/01Public Project Revenue BondsSeries 201407/15/2014$16,155,00002/0124 DEBT LIMIT The statutory limit on debt of Minnesota municipalities other than school districts or cities of the first class (Minnesota Statutes, Section 475.53, subd. 1) is 3% of the Assessor's Estimated Market Value of all taxable property within its boundaries. "Net debt" (Minnesota Statutes, Section 475.51, subd. 4) is the amount remaining after deducting from gross debt the amount of current revenues which are applicable within the current fiscal year to the payment of any debt and the aggregate principal of the following: (1) obligations issued for improvements payable wholly or partly from special assessments levied against benefitted property; (2) warrants or orders having no definite or fixed maturity; (3) obligations payable wholly from the income of revenue producing conveniences; (4) obligations issued to create or maintain a permanent improvement revolving fund; (5) obligations issued to finance any public revenue producing convenience; (6) funds held as sinking funds for payment of principal and interest on debt other than those deductible under Minnesota Statutes, Section 475.51, subd. 4; (7) obligations to repay energy conservation investment loans under Minnesota Statutes, Section 216C.37; (8) obligations issued to pay judgments against the City; and other obligations which are not to be included in computing the net debt of a municipality under the provisions of the law authorizing their issuance. 2021/22 Assessor's Estimated Market Value $13,796,381,100 Multiply by 3%0.03 Statutory Debt Limit $413,891,433 Less:Long-Term Debt Outstanding Being Paid Solely from Taxes (includes the Bonds)*(30,065,000) Less:Long-Term Debt Outstanding Being Paid Solely from Annual Appropriations (HRA)(12,930,000) Unused Debt Limit*$370,896,433 *Preliminary, subject to chnage. 25 OVERLAPPING DEBT1 Taxing District 2021/22 Adjusted Taxable Net Tax Capacity % In City Total G.O. Debt2 City's Proportionate Share County of: Hennepin $2,336,109,435 6.6777%$1,065,595,000 3 $71,157,237 School Districts of: I.S.D. No. 270 (Hopkins Public Schools)148,353,842 7.7521%144,830,000 11,227,366 I.S.D. No. 271 (Bloomington Public Schools)166,358,494 0.0162%140,445,000 4 22,752 I.S.D. No. 272 (Eden Prairie Schools)124,250,639 0.9861%92,635,000 913,474 I.S.D. No. 273 (Edina Public Schools)125,283,801 98.8686%183,225,000 181,151,992 I.S.D. No. 280 (Richfield Public Schools)66,297,431 29.2059%132,980,000 38,838,006 I.S.D. No. 283 (St. Louis Park Public Schools)83,118,061 0.0197%118,895,000 23,422 Special Districts of: Metropolitan Council 5,197,211,231 3.0016%218,520,000 5 6,559,096 Three Rivers Park District 1,631,381,661 9.5623%53,865,000 5,150,733 City's Share of Total Overlapping Debt $315,044,079 1 Overlapping debt is as of the dated date of the Bonds. Only those taxing jurisdictions with general obligation debt outstanding are included in this section. It does not include non-general obligation debt, self-supporting general obligation revenue debt, short-term general obligation debt, or general obligation tax/aid anticipation certificates of indebtedness. 2 Outstanding debt is based on information in Official Statements obtained on EMMA and the Municipal Advisor's records. 3 Hennepin County also has General Obligation Solid Waste Revenue Bonds outstanding which are payable entirely from the County’s solid waste enterprise fund; General Obligation Bonds (Century Plaza Debt) which are expected to be paid from building rental fees from County departments and non-County tenants; and General Obligation Ice Arena Revenue Bonds which are expected to be paid from building rental payments from Augsburg College. These issues have not been included in the overlapping debt or debt ratios. 4 Based upon the long term facilities maintenance revenue formula and current statistics, the District anticipates a portion of this debt will be paid by the State of Minnesota. 5 The above debt includes all outstanding general obligation debt supported by taxes of the Metropolitan Council. The Council also has general obligation sewer revenue, wastewater revenue, and radio revenue bonds and lease obligations outstanding all of which are supported entirely by revenues and have not been included in the Overlapping Debt or Debt Ratios sections. 26 DEBT RATIOS G.O. Debt Debt/Economic Market Value $15,049,883,901 Debt/ Per Capita 53,5721 Direct G.O. Debt Secured By: Municipal Revenues $10,308,000 Special Assessments & Taxes 26,350,000 State Aids 10,465,000 Tax Increment Revenues 7,545,000 Taxes 13,065,000 Utility Revenues 37,667,000 Total General Obligation Debt $105,400,000 Less: G.O. Debt Paid Entirely from Revenues2 (47,975,000) Tax Supported General Obligation Debt $57,425,000 0.38%$1,071.92 City's Share of Total Overlapping Debt $315,044,079 2.09%$5,880.76 Total $372,469,079 2.47%$6,952.68 DEBT PAYMENT HISTORY The City has no record of default in the payment of principal and interest on its debt. FUTURE FINANCING The City has no current plans to issue additional financing in the next 12 months. 1 Estimated 2021 population. 2 Debt service on the City’s general obligation revenue debt is being paid entirely from revenues and therefore is considered self-supporting debt. 27 TAX RATES, LEVIES AND COLLECTIONS TAX LEVIES AND COLLECTIONS Tax Year Net Tax Levy1 Total Collected Following Year Collected to Date2 % Collected 2017/18 $35,662,043 $35,551,096 $35,626,854 99.90% 2018/19 37,228,136 37,104,274 37,204,807 99.94% 2019/20 39,563,814 39,392,703 39,527,478 99.91% 2020/21 41,896,275 41,704,258 41,704,258 99.54% 2021/22 45,370,008 In process of collection Property taxes are collected in two installments in Minnesota--the first by May 15 and the second by October 15.3 Mobile home taxes are collectible in full by August 31. Minnesota Statutes require that levies (taxes and special assessments) for debt service be at least 105% of the actual debt service requirements to allow for delinquencies. The spread of COVID-19 and responses taken by the United States government, state governments, local governments and private industries have caused significant disruptions to the national and State economy. See "RISK FACTORS - Impact of the Spread of COVID-19" herein. Certain states have announced extended deadlines for payment of property taxes, although as of this date Minnesota has not taken such measures. The City cannot predict whether and how much payment of property taxes will be impacted. Any delays or reduction in the receipt of property taxes may materially adversely impact the City's finances and payment of debt obligations, including the Bonds. 1 This reflects the Final Levy Certification of the City after all adjustments have been made. 2 Collections are through January 1, 2022. 3 Second half tax payments on agricultural property are due on November 15th of each year. 28 TAX CAPACITY RATES1 2017/18 2018/19 2019/20 2020/21 2021/22 Hennepin County 42.808%41.861%41.084%38.210%38.535% City of Edina 27.849%27.499%28.082%28.939%29.088% I.S.D. No. 270 (Hopkins Public Schools)29.035%27.022%27.190%26.478%26.783% I.S.D. No. 271 (Bloomington Public Schools)20.764%20.133%19.858%20.251%21.511% I.S.D. No. 272 (Eden Prairie Schools)20.525%20.756%21.555%21.717%20.995% I.S.D. No. 273 (Edina Public Schools)30.972%30.589%30.589%31.474%29.975% I.S.D. No. 280 (Richfield Public Schools)37.050%33.331%32.658%30.517%28.708% I.S.D. No. 283 (St. Louis Park Public Schools)28.615%26.659%25.820%25.846%24.913% Hennepin County Regional Railroad Auth.1.962%1.807%1.388%1.323%1.329% Hennepin County HRA 0.457%0.535%0.801%0.722%0.771% Metro Mosquito 0.456%0.427%0.412%0.381%0.377% Metropolitan Council 0.844%0.659%0.616%0.631%0.659% Metropolitan Transit 1.383%1.456%1.433%1.256%1.204% Park Museum 0.710%0.705%0.710%0.707%0.722% Three Rivers Park District 3.161%2.961%2.859%2.793%2.787% Referendum Market Value Rates: I.S.D. No. 270 (Hopkins Public Schools)0.15045%0.14703%0.16182%0.14358%0.14030% I.S.D. No. 271 (Bloomington Public Schools)0.20361%0.20271%0.19620%0.18647%0.17280% I.S.D. No. 272 (Eden Prairie Schools)0.22945%0.22153%0.20912%0.20120%0.20500% I.S.D. No. 273 (Edina Public Schools)0.22182%0.21038%0.21897%0.21097%0.21895% I.S.D. No. 280 (Richfield Public Schools)0.17401%0.16526%0.14849%0.12789%0.12760% I.S.D. No. 283 (St. Louis Park Public Schools)0.19722%0.18270%0.16574%0.14818%0.14838% Source: Tax Levies and Collections and Tax Capacity Rates have been furnished by Hennepin County. LEVY LIMITS The State Legislature has periodically imposed limitations on the ability of municipalities to levy property taxes. For taxes levied in 2013, payable in 2014, only, the Legislature imposed a one year levy limit on all counties with a population greater than 5,000, and all cities with a population greater than 2,500. While these limitations have expired, the potential exists for future legislation to limit the ability of local governments to levy property taxes. All previous limitations have not limited the ability to levy for the payment of debt service on bonded indebtedness. For more detailed information about Minnesota levy limits, contact the Minnesota Department of Revenue or Ehlers and Associates. 1 After reduction for state aids. Does not include the statewide general property tax against commercial/industrial, non-homestead resorts and seasonal recreational residential property. 29 THE ISSUER CITY GOVERNMENT The City was organized as a municipality in 1888. The City operates under a statutory form of government consisting of a five-member City Council of which the Mayor is a voting member. The City Manager, Finance Director and Assistant Finance Director are responsible for administrative details and financial records. EMPLOYEES; PENSIONS; UNIONS The City currently has 319 full-time, 259 part-time, and 351 seasonal employees. All full-time and certain part-time employees of the City are covered by defined benefit pension plans administered by the Public Employee Retirement Association of Minnesota (PERA). PERA administers the General Employees Retirement Fund (GERF) and the Public Employees Police and Fire Fund (PEPFF) which are cost-sharing multiple-employer retirement plans. PERA members belong to either the Coordinated Plan or the Basic Plan. Coordinated members are covered by Social Security. See the Notes to Financial Statements in Appendix A for a detailed description of the Plans. Recognized and Certified Bargaining Units Bargaining Unit Expiration Date of Current Contract International Association of Firefighters Local 1275 December 31, 2022 Minnesota Teamsters Public & Law Enforcement Local 320 December 31, 2021 Minnesota Public Employees Association Public Safety Dispatchers Local 320 December 31, 2022 IUOE Local 49 (AFL-CIO)December 31, 2023 Status of Contracts The contract which expired on June 30, 2021 is currently in mediation. POST EMPLOYMENT BENEFITS The City has obligations for some post-employment benefits for its employees. Accounting for these obligations is dictated by Governmental Accounting Standards Board Statement No. 75 (GASB 75). The City's most recent actuarial study shows a total OPEB liability of $2,518,251 as of December 31, 2021. The City has been funding these obligations on a pay-as-you-go basis. Source: The City's most recent actuarial study. LITIGATION There is no litigation threatened or pending questioning the organization or boundaries of the City or the right of any of its officers to their respective offices or in any manner questioning their rights and power to execute and deliver the Bonds or otherwise questioning the validity of the Bonds. 30 MUNICIPAL BANKRUPTCY Municipalities are prohibited from filing for bankruptcy under Chapter 11 (reorganization) or Chapter 7 (liquidation) of the U.S. Bankruptcy Code (11 U.S.C. §§ 101-1532) (the "Bankruptcy Code"). Instead, the Bankruptcy Code permits municipalities to file a petition under Chapter 9 of the Bankruptcy Code, but only if certain requirements are met. These requirements include that the municipality must be "specifically authorized" under State law to file for relief under Chapter 9. For these purposes, "State law" may include, without limitation, statutes of general applicability enacted by the State legislature, special legislation applicable to a particular municipality, and/or executive orders issued by an appropriate officer of the State’s executive branch. As of the date hereof, Minnesota Statutes, 471.831, authorizes municipalities to file for bankruptcy relief under Chapter 9 of the Bankruptcy Code. A municipality is defined in United States Code, title 11, section 101, as amended through December 31, 1996, but limited to a county, statutory or home rule charter city, or town; or a housing and redevelopment authority, economic development authority, or rural development financing authority established under Chapter 469, a home rule charter or special law. FUNDS ON HAND (As of June 29, 2022) Fund Total Cash and Investments General $9,477,665 Special Revenue 2,843,008 Debt Service 980,635 Capital Projects 25,105,709 Enterprise Funds 27,890,379 Internal Service Fund 4,467,520 Total Funds on Hand $70,764,916 31 ENTERPRISE FUNDS Revenues available for debt service on the City's enterprise funds have been as follows as of December 31 each year: 2019 20201 2021 Utilities Total Operating Revenues $21,846,239 $25,731,887 $27,663,593 Less:Operating Expenses (18,457,754)(21,401,340)(21,950,832) Operating Income $3,388,485 $4,330,547 $5,712,761 Plus:Depreciation 5,402,610 5,725,846 5,931,178 Revenues Available for Debt Service $8,791,095 $10,056,393 $11,643,939 Liquor Total Operating Revenues $13,094,407 $12,117,414 $14,313,232 Less:Operating Expenses (11,949,857)(11,522,017)(13,519,779) Operating Income $1,144,550 $595,397 $793,453 Plus:Depreciation 103,685 113,853 120,830 Revenues Available for Debt Service $1,248,235 $709,250 $914,283 Aquatic Center Total Operating Revenues $996,778 $0 $1,069,724 Less:Operating Expenses (957,966)(375,188)(1,079,317) Operating Income $38,812 ($375,188)($9,593) Plus:Depreciation 277,330 280,518 283,470 Revenues Available for Debt Service $316,142 ($94,670)$273,877 Golf Course Total Operating Revenues $3,395,815 $3,947,681 $5,384,684 Less:Operating Expenses (3,684,311)(4,027,075)(4,835,667) Operating Income ($288,496)($79,394)$549,017 Plus:Depreciation 756,156 893,542 894,499 Revenues Available for Debt Service $467,660 $814,148 $1,443,516 1 Due to the COVID-19 pandemic, various City enterprise facilities underwent temporary closures in 2020 with the exception of the City’s aquatic facility which was closed for the entire 2020 season. The facilities re-opened under COVID-19 protocols for capacity and social distancing, resulting in reduced operations. The aquatic facility re-opened in 2021, and all facilities continue to operate under COVID-19 protocols. 32 ENTERPRISE FUNDS CONTINUED 2019 20201 2021 Arena Total Operating Revenues $2,516,115 $1,636,138 $2,347,070 Less:Operating Expenses (2,874,276)(2,808,984)(2,846,078) Operating Income ($358,161)($1,172,846)($499,008) Plus:Depreciation 666,629 665,072 657,745 Revenues Available for Debt Service $308,468 ($507,774)$158,737 1 Due to the COVID-19 pandemic, various City enterprise facilities underwent temporary closures in 2020 with the exception of the City’s aquatic facility which was closed for the entire 2020 season. The facilities re-opened under COVID-19 protocols for capacity and social distancing, resulting in reduced operations. The aquatic facility re-opened in 2021, and all facilities continue to operate under COVID-19 protocols. 33 SUMMARY GENERAL FUND INFORMATION COMBINED STATEMENT 2018 Audited 2019 Audited 2020 Audited 2021 Audited 2022 Adopted Budget1 Revenues Property taxes $28,367,096 $29,743,751 $31,901,482 $33,827,443 $36,708,036 Franchise fees 845,178 821,932 811,004 824,286 810,000 Lodging tax 25,298 24,119 8,313 17,214 20,000 License and permits 5,836,167 5,109,994 6,381,889 6,008,225 5,391,060 Intergovernmental 1,737,423 1,585,444 5,976,630 2,564,397 1,888,750 Charges for services 4,686,446 5,190,705 4,812,575 5,536,786 5,737,905 Fines and forteitures 1,042,091 988,254 485,472 460,914 650,000 Investment income 298,135 630,274 597,073 (151,907) 250,000 Rental of property 632,011 487,797 479,148 491,579 339,000 Parkland dedication 0 0 0 0 0 Other revenues 555,463 152,260 132,657 186,591 287,000 Total Revenues $44,025,308 $44,734,530 $51,586,243 $49,765,528 $52,081,751 Expenditures Current: General government $7,159,873 $7,568,505 $7,626,995 $8,825,723 $9,410,820 Public safety 20,204,391 21,514,903 25,411,355 25,527,556 26,567,898 Public works 8,016,635 8,302,557 8,053,512 8,878,567 9,621,712 Parks 5,182,745 5,413,259 4,883,218 5,916,078 6,631,321 Capital outlay 0 0 75,047 26,676 0 Debt service 00000 Total Expenditures $40,563,644 $42,799,224 $46,050,127 $49,174,600 $52,231,751 $3,461,664 $1,935,306 $5,536,116 $590,928 ($150,000) Other Financing Sources (Uses) Utility Contribution $37,978 $0 $0 $0 $0 Sale of capital assets 0 0 75 0 0 Transfers in 50,000 165,494 3,115,261 442,606 150,000 Transfers out (2,039,771) (3,388,864) 0 (4,503,106) 0 Total Other Financing Sources (Uses)(1,951,793) (3,223,370) 3,115,336 (4,060,500) 150,000 $1,509,871 ($1,288,064) $8,651,452 ($3,469,572) $0 General Fund Balance January 1 $18,369,854 $19,879,725 $18,591,661 $27,243,113 Prior Period Adjustment 0 0 0 0 Residual Equity Transfer in (out) 0 0 0 0 General Fund Balance December 31 $19,879,725 $18,591,661 $27,243,113 $23,773,541 DETAILS OF DECEMBER 31 FUND BALANCE Nonspendable $0 $28,403 $28,403 $85,083 Restricted 961,133 58,086 58,086 58,086 Assigned 2,105,741 2,093,760 6,679,877 5,627,113 Unassigned 16,812,851 16,411,412 20,476,747 18,003,259 Total $19,879,725 $18,591,661 $27,243,113 $23,773,541 1 The 2022 budget was adopted on December 13, 2021. Net changes in Fund Balances Excess of revenues over (under) expenditures FISCAL YEAR ENDING DECEMBER 31 Following are summaries of the revenues and expenditures and fund balances for the City's General Fund. These summaries are not purported to be the complete audited financial statements of the City, and potential purchasers should read the included financial statements in their entirety for more complete information concerning the City. Copies of the complete statements are available upon request. Appendix A includes the 2021 audited financial statements. 34 GENERAL INFORMATION LOCATION The City, with a 2020 U.S. Census population of 53,494 and a current population estimate of 53,572, and comprising an area of 16.5 square miles, is located adjacent to the southwest corner of the City of Minneapolis. LARGER EMPLOYERS1 Larger employers in the City include the following: Firm Type of Business/Product Estimated No. of Employees Edina Realty Residential realty services 2,304 2 I.S.D. 273 (Edina Public Schools)Elementary and secondary education 2,000 Coldwell Banker Realty Residential realty services 1,870 2 Fairview Southdale Hospital Hospital and medical services 1,624 3 The City Municipal government and services 929 BI Worldwide Marketing consulting services 737 Dow Water & Process Solutions Water purification/filtration 600 Lund Food Holdings Corporate headquarters and retail grocery stores 500 4 Western National Insurance Company Personal and commercial insurance 430 Target Department store 375 Source:Data Axle Reference Solutions, written and telephone survey, and the Minnesota Department of Employment and Economic Development. 1 This does not purport to be a comprehensive list and is based on available data obtained through a survey of individual employers, as well as the sources identified above. Estimates provided may not reflect changes in the number of employees resulting from the current COVID-19 pandemic. (See "Risk Factors - Impact of the Spread of COVID-19"). 2 Includes agents in remote offices. 3 Includes total number of employees at both retail locations and corporate office in the City. 35 BUILDING PERMITS 2018 2019 2020 2021 20221 New Single Family Homes No. of building permits 1,695 1,885 3,771 3,608 707 Valuation $106,086,177 $103,911,656 $142,742,249 $168,306,886 $57,676,450 New Multiple Family Buildings No. of building permits 135 126 110 130 43 Valuation $95,026,068 $35,245,128 $126,955,104 $30,203,796 $138,706,628 New Commercial/Industrial No. of building permits 340 298 254 291 131 Valuation $142,138,201 $74,113,087 $87,013,432 $71,217,964 $24,398,999 All Building Permits No. of building permits 2,170 2,309 4,135 4,029 881 Valuation $344,150,446 $213,269,871 $357,710,785 $269,662,046 $220,782,087 Source:The City. 1 As of May 23, 2022. 36 U.S. CENSUS DATA Population Trend: The City 2010 U.S. Census population 47,941 2020 U.S. Census population 53,494 2021 Metropolitan Council population estimate 53,572 Percent of Change 2010 - 2020 11.58% Income and Age Statistics The City Hennepin County State of Minnesota United States 2020 per capita income $72,296 $47,618 $38,881 $35,384 2020 median household income $108,576 $81,169 $73,382 $64,994 2020 median family income $151,352 $108,580 $92,692 $80,069 2020 median gross rent $1,442 $1,176 $1,010 $1,096 2020 median value owner occupied units $501,400 $292,100 $235,700 $229,800 2020 median age 44.3 yrs.36.7 yrs.38.1 yrs.38.2 yrs. State of Minnesota United States City % of 2020 per capita income 185.94%204.32% City % of 2020 median family income 185.94%189.03% Housing Statistics The City 2010 2021 Percent of Change All Housing Units 21,655 22,224 2.63% Source:2010 and 2020 Census of Population and Housing, and 2020 American Community Survey (Based on a five-year estimate), U.S. Census Bureau (https://data.census.gov/cedsci) and 2021 Preliminary Population Estimates, Metropolitan Council (https://metrocouncil.org/). EMPLOYMENT/UNEMPLOYMENT DATA Rates are not compiled for individual communities within counties. Average Employment Average Unemployment Year Hennepin County Hennepin County State of Minnesota 2018 685,853 2.5%3.0% 2019 691,497 2.8%3.2% 2020 662,530 6.2%6.2% 2021 667,931 3.6%3.4% 2022, May 702,283 1.6%1.6% Source: Minnesota Department of Employment and Economic Development. 37 APPENDIX A FINANCIAL STATEMENTS Potential purchasers should read the included financial statements in their entirety for more complete information concerning the City’s financial position. Such financial statements have been audited by the Auditor, to the extent and for the periods indicated thereon. The City has not requested or engaged the Auditor to perform, and the Auditor has not performed, any additional examination, assessments, procedures or evaluation with respect to such financial statements since the date thereof or with respect to this Preliminary Official Statement, nor has the City requested that the Auditor consent to the use of such financial statements in this Preliminary Official Statement. Although the inclusion of the financial statements in this Preliminary Official Statement is not intended to demonstrate the fiscal condition of the City since the date of the financial statements, in connection with the issuance of the Bonds, the City represents that there have been no material adverse change in the financial position or results of operations of the City, nor has the City incurred any material liabilities, which would make such financial statements misleading. Copies of the complete audited financial statements for the past three years and the current budget are available upon request from Ehlers. A-1 CITY GOALS: 2021 Annual Comprehensive Financial Report City Of Edina, Minnesota For The Fiscal Year Ended December 31, 2021 Strong Foundation Better TogetherReliable ServiceLivable City A-2 &,7<2)(',1$0,11(627$$118$/&2035(+(16,9(),1$1&,$/5(3257),6&$/<($5(1'(''(&(0%(53UHSDUHGE\ 'HSDUWPHQWRI)LQDQFH$OLVKD0F$QGUHZV±)LQDQFH'LUHFWRU$QGUHD5LFK±$VVLVWDQW)LQDQFH'LUHFWRU3D7KDR±$FFRXQWLQJDQG$XGLWLQJ&RRUGLQDWRU&,7<2)(',1$0,11(627$7$%/(2)&217(176<($5(1'(''(&(0%(5,1752'8&725<6(&7,21 /HWWHURI7UDQVPLWWDO *)2$&HUWLILFDWHRI$FKLHYHPHQW 2UJDQL]DWLRQ 2UJDQL]DWLRQ&KDUW ),1$1&,$/6(&7,21 ,QGHSHQGHQW$XGLWRUV¶5HSRUW 0DQDJHPHQW¶V'LVFXVVLRQDQG$QDO\VLV %DVLF)LQDQFLDO6WDWHPHQWV *RYHUQPHQW:LGH)LQDQFLDO6WDWHPHQWV 6WDWHPHQWRI1HW3RVLWLRQ 6WDWHPHQWRI$FWLYLWLHV )XQG)LQDQFLDO6WDWHPHQWV %DODQFH6KHHW±*RYHUQPHQWDO)XQGV 5HFRQFLOLDWLRQRIWKH%DODQFH6KHHWRI*RYHUQPHQWDO)XQGVWRWKH6WDWHPHQWRI1HW3RVLWLRQ 6WDWHPHQWRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±*RYHUQPHQWDO)XQGV 5HFRQFLOLDWLRQRIWKH6WDWHPHQWRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHVRI*RYHUQPHQWDO)XQGVWRWKH6WDWHPHQWRI$FWLYLWLHV 6WDWHPHQWRI1HW3RVLWLRQ±3URSULHWDU\)XQGV 6WDWHPHQWRI5HYHQXHV([SHQVHVDQG&KDQJHVLQ)XQG1HW3RVLWLRQ±3URSULHWDU\)XQGV 6WDWHPHQWRI&DVK)ORZV±3URSULHWDU\)XQGV 6WDWHPHQWRI)LGXFLDU\1HW3RVLWLRQDQG6WDWHPHQWRI&KDQJHVLQ)LGXFLDU\1HW3RVLWLRQ±&XVWRGLDO)XQGV 1RWHVWR)LQDQFLDO6WDWHPHQWV 5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ %XGJHWDU\&RPSDULVRQ6FKHGXOHV %XGJHWDU\&RPSDULVRQ6FKHGXOH±*HQHUDO)XQG %XGJHWDU\&RPSDULVRQ6FKHGXOH±+RXVLQJDQG5HGHYHORSPHQW$XWKRULW\ +5$ )XQG A-3 &,7<2)(',1$0,11(627$7$%/(2)&217(176 &217,18(' <($5(1'(''(&(0%(52WKHU3RVWHPSOR\PHQW%HQHILWV3ODQ6FKHGXOHRI&KDQJHVLQWKH&LW\¶V7RWDO23(%/LDELOLW\DQG5HODWHG5DWLRV 'HILQHG%HQHILW3HQVLRQ3ODQV*(5)3(3))5HWLUHPHQW)XQGV *(5)6FKHGXOHRI&LW\¶VDQG1RQHPSOR\HU3URSRUWLRQDWH6KDUHRI1HW3HQVLRQ/LDELOLW\DQG6FKHGXOHRI&LW\&RQWULEXWLRQV 3(3))6FKHGXOHRI&LW\¶V3URSRUWLRQDWH6KDUHRI1HW3HQVLRQ/LDELOLW\DQG6FKHGXOHRI&LW\&RQWULEXWLRQV 1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ &RPELQLQJDQG,QGLYLGXDO)XQG)LQDQFLDO6WDWHPHQWVDQG6FKHGXOHV &RPELQLQJ%DODQFH6KHHW±1RQPDMRU*RYHUQPHQWDO)XQGV &RPELQLQJ6WDWHPHQWRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±1RQPDMRU*RYHUQPHQWDO)XQGV 6SHFLDO5HYHQXH)XQG±&RPPXQLW\'HYHORSPHQW%ORFN*UDQW 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 6SHFLDO5HYHQXH)XQG±3ROLFH 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 6SHFLDO5HYHQXH)XQG±%UDHPDU0HPRULDO 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 6SHFLDO5HYHQXH)XQG±3HGHVWULDQDQG&\FOLVW6DIHW\ 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 6SHFLDO5HYHQXH)XQG±$UWVDQG&XOWXUH 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 6SHFLDO5HYHQXH)XQG±&RQVHUYDWLRQDQG6XVWDLQDELOLW\ 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO 0DMRU*RYHUQPHQWDO)XQG±'HEW6HUYLFH 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO &,7<2)(',1$0,11(627$7$%/(2)&217(176 &217,18(' <($5(1'(''(&(0%(50DMRU*RYHUQPHQWDO)XQG±&RQVWUXFWLRQ&DSLWDO3URMHFWV 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±%XGJHWDQG$FWXDO &RPELQLQJ6WDWHPHQWRI1HW3RVLWLRQ±1RQPDMRU3URSULHWDU\)XQGV &RPELQLQJ6WDWHPHQWRI5HYHQXHV([SHQVHVDQG&KDQJHVLQ)XQG1HW3RVLWLRQ±1RQPDMRU3URSULHWDU\)XQGV &RPELQLQJ6WDWHPHQWRI&DVK)ORZV±1RQPDMRU3URSULHWDU\)XQGV &RPELQLQJ%DODQFH6KHHWDQG6WDWHPHQWRI&KDQJHVLQ$VVHWVDQG/LDELOLWLHV±&XVWRGLDO)XQGV 6XSSOHPHQWDU\)LQDQFLDO,QIRUPDWLRQ 7D[&DSDFLW\7D[/HYLHVDQG7D[&DSDFLW\5DWHV &RPELQLQJ6FKHGXOHRI%RQGHG,QGHEWHGQHVV 6FKHGXOHRI%DODQFH6KHHW$FFRXQWV±7D[,QFUHPHQW)LQDQFLQJ'LVWULFWV 6FKHGXOHRI5HYHQXHV([SHQGLWXUHVDQG&KDQJHVLQ)XQG%DODQFHV±7D[,QFUHPHQW)LQDQFLQJ'LVWULFWV 67$7,67,&$/6(&7,21 81$8',7(' )LQDQFLDO7UHQGV 1HW3RVLWLRQE\&RPSRQHQW &KDQJHVLQ1HW3RVLWLRQ )XQG%DODQFHVRI*RYHUQPHQWDO)XQGV &KDQJHVLQ)XQG%DODQFHVRI*RYHUQPHQWDO)XQGV 5HYHQXH&DSDFLW\ $VVHVVHG9DOXH$FWXDO9DOXHDQG7D[&DSDFLW\RI7D[DEOH3URSHUW\ 'LUHFWDQG2YHUODSSLQJ7D[&DSDFLW\5DWHV 3ULQFLSDO3URSHUW\7D[SD\HUV 3URSHUW\7D[/HYLHVDQG&ROOHFWLRQV 'HEW&DSDFLW\ 5DWLRVRI2XWVWDQGLQJ'HEWE\7\SH 5DWLRVRI*HQHUDO%RQGHG'HEW2XWVWDQGLQJ 'LUHFWDQG2YHUODSSLQJ*RYHUQPHQWDO$FWLYLWLHV'HEW /HJDO'HEW0DUJLQ,QIRUPDWLRQ A-4 &,7<2)(',1$0,11(627$7$%/(2)&217(176 &217,18(' <($5(1'(''(&(0%(53OHGJHG5HYHQXH&RYHUDJH 'HPRJUDSKLFDQG(FRQRPLF,QIRUPDWLRQ 'HPRJUDSKLFDQG(FRQRPLF6WDWLVWLFV 3ULQFLSDO(PSOR\HUV 2SHUDWLQJ,QIRUPDWLRQ )XOO7LPH(TXLYDOHQW&LW\*RYHUQPHQW(PSOR\HHVE\)XQFWLRQ 2SHUDWLQJ,QGLFDWRUVE\)XQFWLRQ &DSLWDO$VVHW6WDWLVWLFVE\)XQFWLRQ 0D\7RWKH+RQRUDEOH0D\RU&LW\&RXQFLODQG&LWL]HQVRIWKH&LW\RI(GLQD &LW\ 0LQQHVRWDVWDWXWHVUHTXLUHWKDWHYHU\FLW\SXEOLVKZLWKLQVL[PRQWKVRIWKHFORVHRIHDFKILVFDO\HDUDFRPSOHWHVHWRI DXGLWHG ILQDQFLDO VWDWHPHQWV 7KLV UHSRUW LV SXEOLVKHG WR IXOILOO WKDW UHTXLUHPHQW IRU WKH ILVFDO \HDU HQGHG'HFHPEHU0DQDJHPHQWDVVXPHVIXOOUHVSRQVLELOLW\IRUWKHFRPSOHWHQHVVDQGUHOLDELOLW\RIDOORIWKHLQIRUPDWLRQSUHVHQWHGLQWKLVUHSRUWEDVHGXSRQDFRPSUHKHQVLYHIUDPHZRUNRILQWHUQDOFRQWUROWKDWLWKDVHVWDEOLVKHGIRUWKLVSXUSRVH%HFDXVHWKHFRVWRILQWHUQDOFRQWUROVKRXOGQRWH[FHHGDQWLFLSDWHGEHQHILWVWKHREMHFWLYHLVWRSURYLGHUHDVRQDEOHUDWKHUWKDQDEVROXWHDVVXUDQFHWKDWWKHILQDQFLDOVWDWHPHQWVDUHIUHHIURPPDWHULDOPLVVWDWHPHQW&OLIWRQ/DUVRQ$OOHQ//3DILUPRIOLFHQVHGFHUWLILHGSXEOLFDFFRXQWDQWVKDVLVVXHGDQXQPRGLILHG FOHDQ RSLQLRQRQWKH&LW\¶VILQDQFLDOVWDWHPHQWVIRUWKH\HDUHQGHG'HFHPEHU7KHLQGHSHQGHQWDXGLWRUV¶UHSRUWLVORFDWHGDWWKHIURQWRIWKHILQDQFLDOVHFWLRQRIWKLVUHSRUW0DQDJHPHQW¶V 'LVFXVVLRQ DQG $QDO\VLV 0' $ LPPHGLDWHO\ IROORZV WKH LQGHSHQGHQW DXGLWRUV¶ UHSRUW DQGSURYLGHV D QDUUDWLYH LQWURGXFWLRQ RYHUYLHZ DQG DQDO\VLV RI WKH EDVLF ILQDQFLDO VWDWHPHQWV 7KH 0' $FRPSOHPHQWVWKLVOHWWHURIWUDQVPLWWDODQGVKRXOGEHUHDGLQFRQMXQFWLRQZLWKLW3URILOHRIWKH&LW\7KH&LW\LQFRUSRUDWHGLQLVDIXOO\GHYHORSHGILUVWULQJVXEXUERI0LQQHDSROLV7KH&LW\FXUUHQWO\RFFXSLHVDODQGDUHDRIVTXDUHPLOHVDQGVHUYHVDSRSXODWLRQRI &XUUHQWO\ RIWKH&LW\LVGHYHORSHGZLWKRIWKHODQGDWWULEXWHGWRUHVLGHQWLDOXVHVWRURDGZD\VDQGVXSSRUWLQJWKHSDUNDQGRSHQVSDFHV7KHUHPDLQGHURIWKHODQGLVXVHGIRUFRPPHUFLDOLQGXVWULDODQGSXEOLFVHPLSXEOLFXVHV7KH&LW\LVHPSRZHUHGWROHY\DSURSHUW\WD[RQERWKUHDODQGSHUVRQDOSURSHUW\ORFDWHGZLWKLQLWVERXQGDULHV7KH&LW\KDVRSHUDWHGXQGHUWKH&RXQFLO0DQDJHUIRUPRIJRYHUQPHQWVLQFH 3ROLF\PDNLQJDQGOHJLVODWLYHDXWKRULW\DUHYHVWHGLQD&LW\&RXQFLO &RXQFLO FRQVLVWLQJRIWKH0D\RUDQGIRXURWKHUPHPEHUVDOOHOHFWHGRQDQRQSDUWLVDQEDVLV7KH&RXQFLOLVUHVSRQVLEOHDPRQJRWKHUWKLQJVIRUSDVVLQJRUGLQDQFHVDGRSWLQJWKHEXGJHWDSSRLQWLQJFRPPLWWHHVDQGKLULQJWKH&LW\0DQDJHU7KH&LW\0DQDJHULVUHVSRQVLEOHIRUFDUU\LQJRXWWKHSROLFLHVDQG RUGLQDQFHV RI WKH &RXQFLO IRU RYHUVHHLQJ WKH GD\WRGD\ RSHUDWLRQV RI WKH FLW\ JRYHUQPHQW DQG IRUDSSRLQWLQJ WKH KHDGV RI WKH YDULRXV GHSDUWPHQWV &RXQFLO PHPEHUV VHUYH IRXU\HDU WHUPV ZLWK WZR &RXQFLOPHPEHUVHOHFWHGHYHU\WZR\HDUV7KH0D\RUDOVRVHUYHVDIRXU\HDUWHUP7KH&RXQFLODQG0D\RUDUHHOHFWHGDWODUJH7KH&LW\SURYLGHVDIXOOUDQJHRIVHUYLFHVLQFOXGLQJSROLFHILUHDQGHPHUJHQF\PHGLFDOVHUYLFHV WKHFRQVWUXFWLRQDQGPDLQWHQDQFHRIKLJKZD\VVWUHHWVDQGRWKHULQIUDVWUXFWXUH ZDWHUDQGVHZHUVHUYLFHVDQGUHFUHDWLRQDODQGFXOWXUDODFWLYLWLHVDQGHYHQWV7KH&RXQFLOLVUHTXLUHGWRDGRSWDILQDOEXGJHWE\QRODWHUWKDQWKHFORVHRIWKHSUHYLRXVILVFDO\HDU7KHDQQXDOEXGJHWVHUYHVDVWKHIRXQGDWLRQIRUWKH&LW\¶VILQDQFLDOSODQQLQJDQGFRQWURO7KHEXGJHWLVSUHSDUHGE\IXQGIXQFWLRQ HJ SXEOLF VDIHW\ DQG GHSDUWPHQW HJ SROLFH 'HSDUWPHQW KHDGV PD\ XVH UHVRXUFHV ZLWKLQ DGHSDUWPHQW DV WKH\ VHH ILW 7KH &LW\ 0DQDJHU PD\ DXWKRUL]H WUDQVIHUV RI EXGJHWHG DPRXQWV EHWZHHQGHSDUWPHQWVA-5 /RFDO(FRQRP\7KH&LW\FXUUHQWO\HQMR\VDIDYRUDEOHHFRQRPLFHQYLURQPHQWDQGORFDOLQGLFDWRUVSRLQWWRFRQWLQXHGVWDELOLW\7KHUHJLRQ ZKLOH QRWHG IRU D VWURQJ UHWDLO VHFWRU HQMR\HG FRQVLGHUDEOH UHGHYHORSPHQW LQ UHFHQW \HDUV 7KH UHGHYHORSPHQWFRQVLVWHGRIYDULHGPDQXIDFWXULQJPHGLFDODQGKLJKWHFKEDVHWKDWDGGVWRWKHUHODWLYHVWDELOLW\RIWKHXQHPSOR\PHQWUDWH0DMRULQGXVWULHVZLWKKHDGTXDUWHUVRUGLYLVLRQVZLWKLQWKHJRYHUQPHQW¶VERXQGDULHVRULQFORVHSUR[LPLW\LQFOXGHPHGLFDOVHUYLFHVUHWDLORSHUDWLRQVDQGEDQNLQJVHUYLFHV(GLQDLVKRPHWRRYHUMREVWKDWDUHH[SHFWHGWRUHPDLQVWDEOHRYHUWKHFRPLQJ\HDUV7KH &LW\ KDV EHFRPH NQRZQ IRU LWV TXDOLW\ UHVLGHQWLDO KRXVLQJ VWRFN DQG DWWUDFWLYH QHLJKERUKRRGV 7R GDWHDSSUR[LPDWHO\ RIWKHDYDLODEOHKRXVLQJVWRFNLVLQSODFH$OWKRXJKWKHHPSKDVLVKDVFKDQJHGRYHUWKH\HDUVIURPH[FOXVLYHO\VLQJOHIDPLO\KRXVLQJWRDPRUHEDODQFHGPL[RIKRXVLQJW\SHVWKH&LW\¶VFRQFHUQIRURYHUDOOTXDOLW\LQUHVLGHQWLDOGHYHORSPHQWUHPDLQVDWRSSULRULW\7KH&LW\HQMR\VD$$$ERQGUDWLQJDQGD$DDERQGUDWLQJIURP6WDQGDUGDQG3RRU¶VDQG0RRG\¶VUHVSHFWLYHO\/RQJ7HUP)LQDQFLDO3ODQQLQJ7KH0HWURSROLWDQ&RXQFLOUHTXLUHVDOOFLWLHVLQWKHVHYHQFRXQW\PHWURSROLWDQDUHDWRKDYHD&RPSUHKHQVLYH3ODQDQG VWDWH ODZ UHTXLUHV FLWLHV WR XSGDWH WKHLU SODQV HYHU\ \HDUV 7KH ODVW SODQ ZDV DGRSWHG LQ 7KH&RPSUHKHQVLYH 3ODQ JXLGHV GHYHORSPHQW DQG UHGHYHORSPHQW DQG DGGUHVVHV FKDQJHV OLNHO\ WR RFFXU GXHWRYDULRXVVRFLDODQGPDUNHWIRUFHV7KH&LW\FRQWLQXHVWRIRFXVRQTXDOLW\RIOLIHLPSURYHPHQWVWKURXJKRXW(GLQD7KHVHHIIRUWVFRYHUDEURDGDUUD\RIDUHDVLQFOXGLQJSURWHFWLQJDQGLPSURYLQJWKHHQYLURQPHQWUHYLWDOL]DWLRQRISDUNVDQGSXEOLFDUHDVH[SDQGLQJUHFUHDWLRQDORSSRUWXQLWLHVDGGUHVVLQJUDFHDQGHTXLW\GLVSDULWLHVDQGLQFUHDVLQJFRPPXQLFDWLRQEHWZHHQ&LW\UHSUHVHQWDWLYHVDQGWKHSXEOLF7KH&LW\LVZRUNLQJFORVHO\ZLWKVWDWHJRYHUQPHQWIHGHUDOJRYHUQPHQWDQGQHLJKERULQJFRPPXQLWLHVWRLPSURYHWKHDUHD¶VVWDWHDQGFRXQW\WUDQVSRUWDWLRQQHWZRUNZKLFKLQFOXGHVXSJUDGHGKLJKZD\VDQGZHOOSODFHGSDWKZD\V)XQGLQJIRUPRVWRIWKHWUDQVSRUWDWLRQLPSURYHPHQWVZLOOQHHGWRFRPHIURPVWDWHFRXQW\DQGIHGHUDOVRXUFHVZLWKVRPHPLQRUSRUWLRQVXSSRUWHGE\WKHORFDOWD[SD\HUV5HOHYDQW)LQDQFLDO3ROLFLHV7KH&LW\KDVDGRSWHGDVHWRIILQDQFLDOPDQDJHPHQWSROLFLHVWKDWIRFXVRQORQJWHUPILQDQFLDOSODQQLQJ3ROLFLHVFRYHUDUHDVVXFKDVFDVKDQGLQYHVWPHQWVWKHRSHUDWLQJEXGJHWUHYHQXHIXQGEDODQFHFDSLWDORXWOD\DQGGHEWPDQDJHPHQW$VVLJQPHQWVIRUIXQGEDODQFHVDQGFRPSHQVDWHGDEVHQFHVDUHDOOFDOFXODWHGDVVSHFLILHG LQWKH SROLFLHV,QDGGLWLRQ WKH&LW\KDV XQDVVLJQHG IXQG EDODQFHLQWKHJHQHUDOIXQG7KLVDPRXQWLVDERYHWKHJRDOUDQJHLGHQWLILHGLQWKHSROLF\0DMRU,QLWLDWLYHV7KH &LW\ LV FRQWLQXDOO\ ZRUNLQJ WR XSGDWH RXU DJLQJ LQIUDVWUXFWXUH 2XU DQQXDOO\ DGRSWHG VL[\HDU &DSLWDO,PSURYHPHQW3ODQLQFOXGHVVSHQGLQJDQGILQDQFLQJSURMHFWLRQVIRUWKHVHSURMHFWV $ZDUGVDQG$FNQRZOHGJHPHQWV7KH*RYHUQPHQW)LQDQFH2IILFHUV$VVRFLDWLRQRIWKH8QLWHG6WDWHVDQG&DQDGD *)2$ DZDUGHGD&HUWLILFDWHRI$FKLHYHPHQWIRU([FHOOHQFHLQ)LQDQFLDO5HSRUWLQJWRWKH&LW\RI(GLQDIRULWVDQQXDOFRPSUHKHQVLYHILQDQFLDOUHSRUWIRUWKHILVFDO\HDUHQGHG'HFHPEHU7KLVZDVWKHHOHYHQWKFRQVHFXWLYH\HDUWKDWWKHJRYHUQPHQWKDVDFKLHYHGWKLVSUHVWLJLRXVDZDUG7REHDZDUGHGD&HUWLILFDWHRI$FKLHYHPHQWDJRYHUQPHQWPXVWSXEOLVKDQHDVLO\UHDGDEOHDQGHIILFLHQWO\RUJDQL]HGDQQXDOFRPSUHKHQVLYHILQDQFLDOUHSRUW7KLVUHSRUWPXVWVDWLVI\ERWKJHQHUDOO\DFFHSWHGDFFRXQWLQJSULQFLSOHVDQGDSSOLFDEOHOHJDOUHTXLUHPHQWV$ &HUWLILFDWH RI $FKLHYHPHQW LV YDOLG IRU D SHULRG RI RQH \HDURQO\ :H EHOLHYH WKDW RXU FXUUHQW DQQXDOFRPSUHKHQVLYHILQDQFLDOUHSRUWFRQWLQXHVWRPHHWWKH&HUWLILFDWHRI$FKLHYHPHQW3URJUDP¶VUHTXLUHPHQWVDQGZHDUHVXEPLWWLQJLWWRWKH*)2$WRGHWHUPLQHLWVHOLJLELOLW\IRUDQRWKHUFHUWLILFDWH7KH SUHSDUDWLRQ RI WKLV UHSRUW ZRXOG QRW KDYH EHHQ SRVVLEOH ZLWKRXW WKH GHGLFDWHG VHUYLFHV RI WKH )LQDQFH'HSDUWPHQWVWDII:HZRXOGOLNHWRH[SUHVVRXUDSSUHFLDWLRQWRDOOPHPEHUVRIWKHGHSDUWPHQWZKRDVVLVWHGDQGFRQWULEXWHGWRWKHSUHSDUDWLRQRIWKLVUHSRUW&UHGLWDOVRPXVWEHJLYHQWRWKH0D\RUDQGWKH&LW\&RXQFLOIRUWKHLUXQIDLOLQJ VXSSRUW IRU PDLQWDLQLQJ WKH KLJKHVW VWDQGDUGV RI SURIHVVLRQDOLVP LQ WKH PDQDJHPHQW RI WKH &LW\¶VILQDQFHV5HVSHFWIXOO\VXEPLWWHG$OLVKD0F$QGUHZV)LQDQFH'LUHFWRU$QGUHD5LFK$VVLVWDQW)LQDQFH'LUHFWRU3D7KDR$FFRXQWLQJDQG$XGLWLQJ&RRUGLQDWRUA-6 &,7<2)(',1$0,11(627$25*$1,=$7,21'(&(0%(5 7HUP([SLUHV0D\RU -DPHV+RYODQG 'HFHPEHU&RXQFLO0HPEHUV &DURO\Q-DFNVRQ'HFHPEHU-DPHV3LHUFH'HFHPEHU.HYLQ6WDXQWRQ'HFHPEHU5RQ$QGHUVRQ'HFHPEHU&LW\0DQDJHU 6FRWW1HDO$SSRLQWHG)LQDQFH'LUHFWRU7UHDVXUHU $OLVKD0F$QGUHZV$SSRLQWHG&LW\&OHUN 6KDURQ$OOLVRQ$SSRLQWHGA-7 CLA is an independent member of Nexia International, a leading, global network of independent accounting and consulting firms. See nexia.com/member-firm-disclaimer for details. CliftonLarsonAllen LLP CLAconnect.com ,1'(3(1'(17$8',7256¶5(3257&LW\&RXQFLODQG0DQDJHPHQW&LW\RI(GLQD0LQQHVRWD5HSRUWRQWKH)LQDQFLDO6WDWHPHQWV2SLQLRQV:HKDYHDXGLWHGWKHDFFRPSDQ\LQJILQDQFLDOVWDWHPHQWVRIWKHJRYHUQPHQWDODFWLYLWLHVWKHEXVLQHVVW\SHDFWLYLWLHVHDFKPDMRUIXQGDQGWKHDJJUHJDWHUHPDLQLQJIXQGLQIRUPDWLRQRIWKH&LW\RI(GLQDDVRIDQGIRUWKH\HDUHQGHG'HFHPEHUDQGWKHUHODWHGQRWHVWRWKHILQDQFLDOVWDWHPHQWVZKLFKFROOHFWLYHO\FRPSULVHWKH&LW\RI(GLQDµVEDVLFILQDQFLDOVWDWHPHQWVDVOLVWHGLQWKHWDEOHRIFRQWHQWV,QRXURSLQLRQWKHILQDQFLDOVWDWHPHQWVUHIHUUHGWRDERYHSUHVHQWIDLUO\LQDOOPDWHULDOUHVSHFWVWKHUHVSHFWLYH ILQDQFLDO SRVLWLRQ RI WKH JRYHUQPHQWDO DFWLYLWLHV WKH EXVLQHVVW\SH DFWLYLWLHV HDFK PDMRUIXQGDQGWKHDJJUHJDWHUHPDLQLQJIXQGLQIRUPDWLRQRIWKH&LW\RI(GLQDDVRI'HFHPEHUDQGWKHUHVSHFWLYHFKDQJHVLQILQDQFLDOSRVLWLRQDQGZKHUHDSSOLFDEOHFDVKIORZVWKHUHRIIRUWKH\HDUWKHQHQGHGLQDFFRUGDQFHZLWKDFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD%DVLVIRU2SLQLRQV:HFRQGXFWHGRXUDXGLWLQDFFRUGDQFHZLWKDXGLWLQJVWDQGDUGVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD *$$6 DQGWKHVWDQGDUGVDSSOLFDEOHWRILQDQFLDODXGLWVFRQWDLQHGLQ*RYHUQPHQW$XGLWLQJ6WDQGDUGVLVVXHGE\WKH&RPSWUROOHU*HQHUDORIWKH8QLWHG6WDWHV2XUUHVSRQVLELOLWLHVXQGHUWKRVHVWDQGDUGV DUH IXUWKHU GHVFULEHG LQ WKH $XGLWRUV¶ 5HVSRQVLELOLWLHV IRU WKH $XGLW RI WKH )LQDQFLDO6WDWHPHQWVVHFWLRQRIRXUUHSRUW:HDUHUHTXLUHGWREHLQGHSHQGHQWRIWKH&LW\RI(GLQDDQGWRPHHWRXURWKHUHWKLFDOUHVSRQVLELOLWLHVLQDFFRUGDQFHZLWKWKHUHOHYDQWHWKLFDOUHTXLUHPHQWVUHODWLQJWRRXUDXGLW:HEHOLHYHWKDWWKHDXGLWHYLGHQFHZHKDYHREWDLQHGLVVXIILFLHQWDQGDSSURSULDWHWRSURYLGHDEDVLVIRURXUDXGLWRSLQLRQV5HVSRQVLELOLWLHVRI0DQDJHPHQWIRUWKH)LQDQFLDO6WDWHPHQWV0DQDJHPHQW LV UHVSRQVLEOH IRU WKH SUHSDUDWLRQ DQG IDLU SUHVHQWDWLRQ RI WKH ILQDQFLDO VWDWHPHQWV LQDFFRUGDQFHZLWKDFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFDDQGIRUWKHGHVLJQ LPSOHPHQWDWLRQ DQG PDLQWHQDQFH RI LQWHUQDO FRQWURO UHOHYDQWWRWKHSUHSDUDWLRQDQGIDLUSUHVHQWDWLRQRIILQDQFLDOVWDWHPHQWVWKDWDUHIUHHIURPPDWHULDOPLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURU,QSUHSDULQJWKHILQDQFLDOVWDWHPHQWVPDQDJHPHQWLVUHTXLUHGWRHYDOXDWHZKHWKHUWKHUHDUHFRQGLWLRQVRUHYHQWVFRQVLGHUHGLQWKHDJJUHJDWHWKDWUDLVHVXEVWDQWLDOGRXEWDERXWWKH&LW\RI(GLQDµVDELOLW\WRFRQWLQXHDVDJRLQJFRQFHUQIRUWZHOYHPRQWKVEH\RQGWKHILQDQFLDOVWDWHPHQW GDWH LQFOXGLQJ DQ\FXUUHQWO\NQRZQLQIRUPDWLRQWKDWPD\UDLVHVXEVWDQWLDOGRXEWVKRUWO\WKHUHDIWHUA-8 &LW\&RXQFLODQG0DQDJHPHQW&LW\RI(GLQD0LQQHVRWD $XGLWRUV¶5HVSRQVLELOLWLHVIRUWKH$XGLWRIWKH)LQDQFLDO6WDWHPHQWV2XUREMHFWLYHVDUHWRREWDLQUHDVRQDEOHDVVXUDQFHDERXWZKHWKHUWKHILQDQFLDOVWDWHPHQWVDVDZKROHDUHIUHHIURPPDWHULDOPLVVWDWHPHQWZKHWKHUGXHWRIUDXGRUHUURUDQGWRLVVXHDQDXGLWRUV¶UHSRUWWKDWLQFOXGHVRXURSLQLRQV5HDVRQDEOHDVVXUDQFHLVDKLJKOHYHORIDVVXUDQFHEXWLVQRWDEVROXWHDVVXUDQFHDQGWKHUHIRUHLVQRWDJXDUDQWHHWKDWDQDXGLWFRQGXFWHGLQDFFRUGDQFHZLWK*$$6DQG*RYHUQPHQW$XGLWLQJ6WDQGDUGVZLOODOZD\VGHWHFWDPDWHULDOPLVVWDWHPHQWZKHQLWH[LVWV7KHULVNRIQRWGHWHFWLQJDPDWHULDOPLVVWDWHPHQWUHVXOWLQJIURPIUDXGLVKLJKHUWKDQIRURQHUHVXOWLQJIURPHUURUDVIUDXGPD\LQYROYHFROOXVLRQIRUJHU\LQWHQWLRQDORPLVVLRQVPLVUHSUHVHQWDWLRQVRUWKHRYHUULGHRILQWHUQDOFRQWURO0LVVWDWHPHQWVDUHFRQVLGHUHGPDWHULDOLIWKHUHLVDVXEVWDQWLDO OLNHOLKRRG WKDW LQGLYLGXDOO\ RU LQ WKHDJJUHJDWH WKH\ ZRXOG LQIOXHQFH WKH MXGJPHQW PDGH E\ D UHDVRQDEOH XVHU EDVHG RQ WKH ILQDQFLDOVWDWHPHQWV,QSHUIRUPLQJDQDXGLWLQDFFRUGDQFHZLWK*$$6DQG*RYHUQPHQW$XGLWLQJ6WDQGDUGVZH x ([HUFLVHSURIHVVLRQDOMXGJPHQWDQGPDLQWDLQSURIHVVLRQDOVNHSWLFLVPWKURXJKRXWWKHDXGLWx ,GHQWLI\DQGDVVHVVWKHULVNVRIPDWHULDOPLVVWDWHPHQWRIWKHILQDQFLDOVWDWHPHQWVZKHWKHUGXHWRIUDXGRUHUURUDQGGHVLJQDQGSHUIRUPDXGLWSURFHGXUHVUHVSRQVLYHWRWKRVHULVNV6XFKSURFHGXUHVLQFOXGHH[DPLQLQJRQDWHVWEDVLVHYLGHQFHUHJDUGLQJWKHDPRXQWVDQGGLVFORVXUHVLQWKHILQDQFLDOVWDWHPHQWVx 2EWDLQ DQ XQGHUVWDQGLQJ RI LQWHUQDO FRQWURO UHOHYDQW WR WKH DXGLW LQ RUGHU WR GHVLJQ DXGLWSURFHGXUHVWKDWDUHDSSURSULDWHLQWKHFLUFXPVWDQFHVEXWQRWIRUWKHSXUSRVHRIH[SUHVVLQJDQRSLQLRQRQWKHHIIHFWLYHQHVVRIWKH&LW\RI(GLQDµVLQWHUQDOFRQWURO$FFRUGLQJO\QRVXFKRSLQLRQLVH[SUHVVHGx (YDOXDWHWKHDSSURSULDWHQHVVRIDFFRXQWLQJSROLFLHVXVHGDQGWKHUHDVRQDEOHQHVVRIVLJQLILFDQWDFFRXQWLQJHVWLPDWHVPDGHE\PDQDJHPHQWDVZHOODVHYDOXDWHWKHRYHUDOOSUHVHQWDWLRQRIWKHILQDQFLDOVWDWHPHQWVx &RQFOXGHZKHWKHULQRXUMXGJPHQWWKHUHDUHFRQGLWLRQVRUHYHQWVFRQVLGHUHGLQWKHDJJUHJDWHWKDWUDLVHVXEVWDQWLDOGRXEWDERXWWKH&LW\RI(GLQDµVDELOLW\WRFRQWLQXHDVDJRLQJFRQFHUQIRUDUHDVRQDEOHSHULRGRIWLPH:HDUHUHTXLUHGWRFRPPXQLFDWHZLWKWKRVHFKDUJHGZLWKJRYHUQDQFHUHJDUGLQJDPRQJRWKHUPDWWHUVWKHSODQQHGVFRSHDQGWLPLQJRIWKHDXGLWVLJQLILFDQWDXGLWILQGLQJVDQGFHUWDLQLQWHUQDOFRQWUROUHODWHGPDWWHUVWKDWZHLGHQWLILHGGXULQJWKHDXGLW&LW\&RXQFLODQG0DQDJHPHQW&LW\RI(GLQD0LQQHVRWD 5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ$FFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHG LQ WKH 8QLWHG 6WDWHV RI $PHULFD UHTXLUH WKDW WKHPDQDJHPHQW¶V GLVFXVVLRQ DQG DQDO\VLV EXGJHWDU\ FRPSDULVRQ LQIRUPDWLRQ 2WKHU 3RVWHPSOR\PHQW%HQHILWV3ODQ6FKHGXOHRI&KDQJHVLQWKH&LW\¶V7RWDO23(%/LDELOLW\DQG5HODWHG5DWLRQVDQG'HILQHG%HQHILW3HQVLRQ3ODQV6FKHGXOHVEHSUHVHQWHGWRVXSSOHPHQWWKHEDVLFILQDQFLDOVWDWHPHQWV6XFKLQIRUPDWLRQ LV WKH UHVSRQVLELOLW\ RI PDQDJHPHQW DQG DOWKRXJK QRWDSDUWRIWKHEDVLFILQDQFLDOVWDWHPHQWVLVUHTXLUHGE\WKH*RYHUQPHQWDO$FFRXQWLQJ6WDQGDUGV%RDUGZKRFRQVLGHUVLWWREHDQHVVHQWLDO SDUW RI ILQDQFLDO UHSRUWLQJ IRU SODFLQJ WKH EDVLF ILQDQFLDO VWDWHPHQWV LQ DQ DSSURSULDWHRSHUDWLRQDOHFRQRPLFRUKLVWRULFDOFRQWH[W:HKDYHDSSOLHGFHUWDLQOLPLWHGSURFHGXUHVWRWKHUHTXLUHGVXSSOHPHQWDU\ LQIRUPDWLRQ LQ DFFRUGDQFH ZLWK *$$6 ZKLFK FRQVLVWHG RI LQTXLULHV RI PDQDJHPHQWDERXWWKHPHWKRGVRISUHSDULQJWKHLQIRUPDWLRQDQGFRPSDULQJWKHLQIRUPDWLRQIRUFRQVLVWHQF\ZLWKPDQDJHPHQW¶V UHVSRQVHV WR RXU LQTXLULHV WKH EDVLF ILQDQFLDO VWDWHPHQWV DQG RWKHU NQRZOHGJH ZHREWDLQHGGXULQJRXUDXGLWRIWKHEDVLFILQDQFLDOVWDWHPHQWV:HGRQRWH[SUHVVDQRSLQLRQRUSURYLGHDQ\DVVXUDQFHRQWKHLQIRUPDWLRQEHFDXVHWKHOLPLWHGSURFHGXUHV GRQRWSURYLGHXVZLWKVXIILFLHQWHYLGHQFHWRH[SUHVVDQRSLQLRQRUSURYLGHDQ\DVVXUDQFH6XSSOHPHQWDU\,QIRUPDWLRQ2XU DXGLW ZDV FRQGXFWHG IRU WKHSXUSRVH RI IRUPLQJ RSLQLRQV RQWKH ILQDQFLDO VWDWHPHQWV WKDWFROOHFWLYHO\FRPSULVHWKH&LW\RI(GLQDµVEDVLFILQDQFLDOVWDWHPHQWV7KHFRPELQLQJDQGLQGLYLGXDOIXQGILQDQFLDOVWDWHPHQWVDQGVFKHGXOHV7D[&DSDFLW\7D[/HYLHVDQG7D[&DSDFLW\5DWHVLQIRUPDWLRQ&RPELQLQJ6FKHGXOHRI%RQGHG,QGHEWHGQHVVDQG7D[,QFUHPHQW)LQDQFLQJ'LVWULFW6FKHGXOHVDUHSUHVHQWHG IRU SXUSRVHV RI DGGLWLRQDO DQDO\VLV DQG DUH QRW D UHTXLUHG SDUW RI WKH EDVLF ILQDQFLDOVWDWHPHQWV6XFKLQIRUPDWLRQLVWKHUHVSRQVLELOLW\RIPDQDJHPHQWDQGZDVGHULYHGIURPDQGUHODWHVGLUHFWO\WRWKHXQGHUO\LQJDFFRXQWLQJDQGRWKHUUHFRUGVXVHGWRSUHSDUHWKHEDVLFILQDQFLDOVWDWHPHQWV7KHLQIRUPDWLRQKDVEHHQVXEMHFWHGWRWKHDXGLWLQJSURFHGXUHVDSSOLHGLQWKHDXGLWRIWKHEDVLFILQDQFLDOVWDWHPHQWVDQGFHUWDLQDGGLWLRQDOSURFHGXUHVLQFOXGLQJFRPSDULQJDQGUHFRQFLOLQJVXFKLQIRUPDWLRQGLUHFWO\WRWKHXQGHUO\LQJDFFRXQWLQJDQGRWKHUUHFRUGVXVHGWRSUHSDUHWKHEDVLFILQDQFLDOVWDWHPHQWVRUWRWKHEDVLFILQDQFLDOVWDWHPHQWVWKHPVHOYHVDQGRWKHUDGGLWLRQDOSURFHGXUHVLQDFFRUGDQFHZLWK*$$6 ,Q RXU RSLQLRQ WKH FRPELQLQJ DQG LQGLYLGXDO IXQG ILQDQFLDO VWDWHPHQWV DQG VFKHGXOHV 7D[&DSDFLW\ 7D[ /HYLHV DQG 7D[ &DSDFLW\ 5DWHV LQIRUPDWLRQ &RPELQLQJ 6FKHGXOH RI %RQGHG,QGHEWHGQHVV DQG 7D[ ,QFUHPHQW )LQDQFLQJ 'LVWULFW 6FKHGXOHV DUH IDLUO\ VWDWHG LQ DOO PDWHULDOUHVSHFWVLQUHODWLRQWRWKHEDVLFILQDQFLDOVWDWHPHQWVDVDZKROH2WKHU,QIRUPDWLRQ0DQDJHPHQW LV UHVSRQVLEOH IRU WKH RWKHU LQIRUPDWLRQ LQFOXGHG LQ WKH DQQXDO UHSRUW 7KH RWKHULQIRUPDWLRQFRPSULVHVWKHLQWURGXFWRU\DQGVWDWLVWLFDOVHFWLRQVEXWGRHVQRWLQFOXGHWKHEDVLFILQDQFLDOVWDWHPHQWVDQGRXUDXGLWRUV¶UHSRUWWKHUHRQ2XURSLQLRQVRQWKHEDVLFILQDQFLDOVWDWHPHQWVGRQRWFRYHUWKHRWKHULQIRUPDWLRQDQGZHGRQRWH[SUHVVDQRSLQLRQRUDQ\IRUPRIDVVXUDQFHWKHUHRQ,QFRQQHFWLRQZLWKRXUDXGLWRIWKHEDVLFILQDQFLDOVWDWHPHQWVRXUUHVSRQVLELOLW\LVWRUHDGWKHRWKHULQIRUPDWLRQDQGFRQVLGHUZKHWKHUDPDWHULDOLQFRQVLVWHQF\H[LVWVEHWZHHQWKHRWKHULQIRUPDWLRQDQGWKHEDVLFILQDQFLDOVWDWHPHQWVRUWKHRWKHULQIRUPDWLRQRWKHUZLVHDSSHDUVWREHPDWHULDOO\PLVVWDWHG,IEDVHGRQWKHZRUNSHUIRUPHGZHFRQFOXGHWKDWDQXQFRUUHFWHGPDWHULDOPLVVWDWHPHQWRIWKHRWKHULQIRUPDWLRQH[LVWVZHDUHUHTXLUHGWRGHVFULEHLWLQRXUUHSRUWA-9 &LW\&RXQFLODQG0DQDJHPHQW&LW\RI(GLQD0LQQHVRWD 2WKHU5HSRUWLQJ5HTXLUHGE\*RYHUQPHQW$XGLWLQJ6WDQGDUGV,QDFFRUGDQFHZLWK*RYHUQPHQW$XGLWLQJ6WDQGDUGVZHKDYHDOVRLVVXHGRXUUHSRUWGDWHG0D\RQRXUFRQVLGHUDWLRQRIWKH&LW\RI(GLQD¶VLQWHUQDOFRQWURORYHUILQDQFLDOUHSRUWLQJDQGRQRXUWHVWVRILWVFRPSOLDQFHZLWKFHUWDLQSURYLVLRQVRIODZVUHJXODWLRQVFRQWUDFWVDQGJUDQWDJUHHPHQWVDQGRWKHUPDWWHUV7KHSXUSRVHRIWKDWUHSRUWLVVROHO\WRGHVFULEHWKHVFRSHRIRXUWHVWLQJRILQWHUQDOFRQWURORYHUILQDQFLDOUHSRUWLQJDQGFRPSOLDQFHDQGWKHUHVXOWVRIWKDWWHVWLQJDQGQRWWRSURYLGHDQRSLQLRQRQWKHHIIHFWLYHQHVVRIWKH&LW\RI(GLQD¶VLQWHUQDOFRQWURORYHUILQDQFLDOUHSRUWLQJRURQFRPSOLDQFH7KDWUHSRUWLVDQLQWHJUDOSDUWRIDQDXGLWSHUIRUPHGLQDFFRUGDQFHZLWK*RYHUQPHQW$XGLWLQJ6WDQGDUGVLQFRQVLGHULQJ&LW\RI(GLQD¶VLQWHUQDOFRQWURORYHUILQDQFLDOUHSRUWLQJDQGFRPSOLDQFH&OLIWRQ/DUVRQ$OOHQ//30LQQHDSROLV0LQQHVRWD0D\ 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ A-10 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 $VPDQDJHPHQWRIWKH&LW\RI(GLQD WKH&LW\ ZHRIIHUUHDGHUVRIWKH&LW\¶VILQDQFLDOVWDWHPHQWVWKLVQDUUDWLYH RYHUYLHZ DQG DQDO\VLV RI WKH ILQDQFLDO DFWLYLWLHV RIWKH &LW\ IRU WKH ILVFDO \HDU HQGHG'HFHPEHU:HHQFRXUDJHUHDGHUVWRFRQVLGHUWKHLQIRUPDWLRQSUHVHQWHGKHUHLQFRQMXQFWLRQZLWKDGGLWLRQDOLQIRUPDWLRQWKDWZHKDYHIXUQLVKHGLQRXUOHWWHURIWUDQVPLWWDOZKLFKSUHFHGHVWKLVUHSRUW),1$1&,$/+,*+/,*+76x 7KHDVVHWVDQGGHIHUUHGRXWIORZVRIUHVRXUFHVRIWKH&LW\H[FHHGHGLWVOLDELOLWLHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVDWWKHFORVHRIWKHPRVWUHFHQWILVFDO\HDUE\ QHWSRVLWLRQ 2IWKLVDPRXQW XQUHVWULFWHGQHWSRVLWLRQ PD\EHXVHGWRPHHWWKH&LW\¶VRQJRLQJREOLJDWLRQVWRFLWL]HQVDQGFUHGLWRUVLQDFFRUGDQFHZLWKWKH&LW\¶VIXQGGHVLJQDWLRQVDQGILVFDOSROLFLHVx 7KH &LW\¶V WRWDO QHW SRVLWLRQ LQFUHDVHG E\ IURP WKH SULRU \HDU 2I WKDW WRWDO LV WKH LQFUHDVH LQ *RYHUQPHQWDO $FWLYLWLHV QHW SRVLWLRQDQG LVWKHLQFUHDVHLQ%XVLQHVV7\SH$FWLYLWLHVQHWSRVLWLRQx $WWKHFORVHRIWKHILVFDO\HDUWKH&LW\¶VJRYHUQPHQWDOIXQGVUHSRUWHGFRPELQHGHQGLQJIXQGEDODQFHVRIDQLQFUHDVHRI IURPWKHSULRU\HDU7KHLQFUHDVHFDQ EH DWWULEXWHG WR LQFUHDVHV LQ WKH 'HEW 6HUYLFH &RQVWUXFWLRQ DQG +RXVLQJ DQG5HGHYHORSPHQW$XWKRULW\ +5$ IXQGVo *HQHUDO REOLJDWLRQ ERQGV VHULHV $ ZDV LVVXHG LQ LQ WKH DPRXQW RIo *HQHUDO 2EOLJDWLRQ %RQGV 6HULHV % ZDV LVVXHGWR UHIXQG JHQHUDOREOLJDWLRQVVHULHV$ZLWKWKHUHIXQGLQJQRWRFFXUULQJXQWLOo *HQHUDO2EOLJDWLRQ5HFUHDWLRQDO5HYHQXH%RQGV6HULHV&ZDVLVVXHGWRUHIXQGVHULHV&ERQGVZLWKWKHUHIXQGLQJQRWRFFXUULQJXQWLOo 7KH+5$)XQGEDODQFHLQFUHDVHGIURPWD[LQFUHPHQWFROOHFWLRQVDIIRUGDEOHKRXVLQJIHHVFROOHFWHGWKH$ERQGLVVXDQFHIRUSXEOLFLPSURYHPHQWSURMHFWVLQWKH*UDQGYLHZ7,)GLVWULFWDQGWKHVDOHRIWKH:HVWWK6WUHHWSURSHUW\x $W WKH HQG RI WKH FXUUHQW ILVFDO \HDU XQDVVLJQHG IXQG EDODQFH IRU WKH JHQHUDO IXQG ZDV RURIWRWDOJHQHUDOIXQGH[SHQGLWXUHVx 7KH &LW\¶V WRWDO ERQGHG GHEW LQFUHDVHG E\ GXULQJ WKH FXUUHQW ILVFDO \HDU IURPDWWKHHQGRIGXHWRWKHGHEWLVVXDQFHPHQWLRQHGDERYH29(59,(:2)7+(),1$1&,$/67$7(0(1767KLV GLVFXVVLRQ DQG DQDO\VLV LV LQWHQGHG WR VHUYH DV DQ LQWURGXFWLRQ WR WKH &LW\¶V EDVLF ILQDQFLDOVWDWHPHQWV 7KH &LW\¶VEDVLF ILQDQFLDO VWDWHPHQWV FRPSULVH WKUHH FRPSRQHQWV JRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV IXQGILQDQFLDOVWDWHPHQWVDQG QRWHVWRWKHILQDQFLDOVWDWHPHQWV7KLVUHSRUWDOVRFRQWDLQVRWKHUVXSSOHPHQWDU\LQIRUPDWLRQLQDGGLWLRQWRWKHEDVLFILQDQFLDOVWDWHPHQWV*RYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV7KHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVDUHGHVLJQHGWRSURYLGHUHDGHUVZLWKDEURDGRYHUYLHZRIWKH&LW\¶VILQDQFHVLQDPDQQHUVLPLODUWRDSULYDWHVHFWRUEXVLQHVV7KHVWDWHPHQW RIQHWSRVLWLRQSUHVHQWVLQIRUPDWLRQRQDOORIWKH&LW\¶VDVVHWVGHIHUUHGRXWIORZVRIUHVRXUFHVOLDELOLWLHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVZLWKWKHGLIIHUHQFHEHWZHHQWKHPUHSRUWHGDVQHW SRVLWLRQ 2YHUWLPH LQFUHDVHV RU GHFUHDVHV LQ QHW SRVLWLRQ PD\VHUYH DV D XVHIXO LQGLFDWRU RIZKHWKHUWKHILQDQFLDOSRVLWLRQRIWKH&LW\LVLPSURYLQJRUGHWHULRUDWLQJ&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 7KHVWDWHPHQWRIDFWLYLWLHVSUHVHQWVLQIRUPDWLRQVKRZLQJKRZWKH&LW\¶VQHWSRVLWLRQFKDQJHGGXULQJWKHPRVWUHFHQWILVFDO\HDU$OOFKDQJHVLQQHWSRVLWLRQDUHUHSRUWHGDVVRRQDVWKHXQGHUO\LQJHYHQWJLYLQJULVHWRWKHFKDQJHRFFXUVUHJDUGOHVVRIWKHWLPLQJRIUHODWHGFDVKIORZV7KXVUHYHQXHVDQGH[SHQVHVDUHUHSRUWHGLQWKLVVWDWHPHQWIRUVRPHLWHPVWKDWZLOORQO\UHVXOWLQFDVKIORZVLQIXWXUHILVFDOSHULRGV HJXQFROOHFWHGWD[HVDQGHDUQHGEXWXQXVHGYDFDWLRQOHDYH %RWKRIWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVGLVWLQJXLVKIXQFWLRQVRIWKH&LW\WKDWDUHSULQFLSDOO\VXSSRUWHGE\WD[HVDQGLQWHUJRYHUQPHQWDOUHYHQXHV JRYHUQPHQWDODFWLYLWLHV IURPRWKHUIXQFWLRQVWKDWDUH LQWHQGHG WR UHFRYHU DOO RU D VLJQLILFDQW SRUWLRQ RI WKHLU FRVWV WKURXJK XVHU IHHV DQG FKDUJHV EXVLQHVVW\SHDFWLYLWLHV 7KHJRYHUQPHQWDODFWLYLWLHVRIWKH&LW\LQFOXGHJHQHUDOJRYHUQPHQWSXEOLFVDIHW\ SXEOLF ZRUNV DQG SDUNV 7KH EXVLQHVVW\SH DFWLYLWLHV RI WKH &LW\ LQFOXGH ZDWHU VHZHUVWRUPZDWHUUHF\FOLQJOLTXRUDTXDWLFFHQWHUJROIFRXUVHDUHQDDQGFRPPXQLW\DFWLYLW\FHQWHUV)XQGILQDQFLDOVWDWHPHQWV$IXQGLVDJURXSLQJRIUHODWHGDFFRXQWVWKDWLVXVHGWRPDLQWDLQFRQWURORYHUUHVRXUFHVWKDWKDYHEHHQVHJUHJDWHGIRUVSHFLILFDFWLYLWLHVRUREMHFWLYHV7KH&LW\OLNHRWKHUVWDWHDQGORFDOJRYHUQPHQWV XVHVIXQGDFFRXQWLQJ WRHQVXUHDQGGHPRQVWUDWH FRPSOLDQFH ZLWK ILQDQFHUHODWHGOHJDOUHTXLUHPHQWV$OOWKHIXQGVRIWKH&LW\FDQEHGLYLGHGLQWRWKUHHFDWHJRULHV JRYHUQPHQWDOIXQGVSURSULHWDU\IXQGVDQGILGXFLDU\IXQGV*RYHUQPHQWDO IXQGV*RYHUQPHQWDO IXQGV DUH XVHG WR DFFRXQW IRU HVVHQWLDOO\ WKH VDPHIXQFWLRQV UHSRUWHG DV JRYHUQPHQWDO DFWLYLWLHV LQ WKH JRYHUQPHQWZLGH ILQDQFLDO VWDWHPHQWV+RZHYHU XQOLNH WKH JRYHUQPHQWZLGH ILQDQFLDO VWDWHPHQWV JRYHUQPHQWDO IXQG ILQDQFLDOVWDWHPHQWV IRFXV RQ QHDUWHUP LQIORZV DQG RXWIORZV RI VSHQGDEOH UHVRXUFHV DV ZHOO DV RQEDODQFHVRIVSHQGDEOHUHVRXUFHVDYDLODEOHDWWKHHQGRIWKHILVFDO\HDU6XFKLQIRUPDWLRQPD\EHXVHIXOLQHYDOXDWLQJDJRYHUQPHQW¶VQHDUWHUPILQDQFLDOUHTXLUHPHQWV%HFDXVHWKHIRFXVRIJRYHUQPHQWDOIXQGVLVQDUURZHUWKDQWKDWRIWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVLWLVXVHIXOWRFRPSDUHWKHLQIRUPDWLRQSUHVHQWHGIRUJRYHUQPHQWDOIXQGVZLWKVLPLODULQIRUPDWLRQSUHVHQWHGIRUJRYHUQPHQWDODFWLYLWLHVLQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQW%\GRLQJVRUHDGHUVPD\EHWWHUXQGHUVWDQGWKHORQJWHUPLPSDFWRIWKH&LW\¶VQHDUWHUPILQDQFLDOGHFLVLRQV %RWK WKH JRYHUQPHQWDO IXQG EDODQFH VKHHW DQG JRYHUQPHQWDO IXQG VWDWHPHQW RIUHYHQXHVH[SHQGLWXUHVDQGFKDQJHLQIXQGEDODQFHVSURYLGHDUHFRQFLOLDWLRQWRIDFLOLWDWHWKLVFRPSDULVRQEHWZHHQJRYHUQPHQWDOIXQGVDQGJRYHUQPHQWDODFWLYLWLHV7KH &LW\ PDLQWDLQV IRXU LQGLYLGXDO PDMRU JRYHUQPHQWDO IXQGV ,QIRUPDWLRQ LV SUHVHQWHGVHSDUDWHO\LQWKHJRYHUQPHQWDOIXQGEDODQFHVKHHWDQGLQWKHJRYHUQPHQWDOIXQGVWDWHPHQWRIUHYHQXHV H[SHQGLWXUHV DQG FKDQJHV LQ IXQG EDODQFHV IRU WKH JHQHUDO IXQG +RXVLQJ DQG5HGHYHORSPHQW$XWKRULW\IXQGGHEWVHUYLFHIXQGDQGWKHFRQVWUXFWLRQIXQG'DWDIURPWKHRWKHUJRYHUQPHQWDOIXQGVDUHFRPELQHGLQWRDVLQJOHDJJUHJDWHGSUHVHQWDWLRQ,QGLYLGXDOIXQGGDWDIRUHDFKRIWKHVHQRQPDMRUJRYHUQPHQWDOIXQGVDUHSURYLGHGLQWKHIRUPRIFRPELQLQJVWDWHPHQWVHOVHZKHUHLQWKLVUHSRUW7KH&LW\DGRSWVDQDQQXDODSSURSULDWHGEXGJHWIRUDOOJRYHUQPHQWDODQGSURSULHWDU\IXQGV$EXGJHWDU\FRPSDULVRQVWDWHPHQWKDVEHHQSURYLGHGIRUDOOJRYHUQPHQWDOIXQGVWRGHPRQVWUDWHFRPSOLDQFHZLWKWKHVHEXGJHWVA-11 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 3URSULHWDU\IXQGV7KH&LW\PDLQWDLQVILYHPDMRU HQWHUSULVHIXQGV DQG IRXU LQWHUQDO VHUYLFHIXQGV (QWHUSULVH IXQGV DUH XVHG WR UHSRUW WKH VDPH IXQFWLRQV SUHVHQWHG DV EXVLQHVVW\SHDFWLYLWLHVLQWKHJRYHUQPHQWDOZLGHILQDQFLDOVWDWHPHQWV7KH&LW\¶VPDMRUHQWHUSULVHIXQGVDUHXVHGWRDFFRXQWIRULWVXWLOLW\OLTXRUDTXDWLFFHQWHUJROIDQGDUHQDRSHUDWLRQV'DWD IURP WKH RWKHU HQWHUSULVH IXQGV DUH FRPELQHG LQWR D VLQJOH DJJUHJDWHG SUHVHQWDWLRQ,QGLYLGXDOIXQGGDWDIRUHDFKRIWKHVHQRQPDMRUHQWHUSULVHIXQGVDUHSURYLGHGLQWKHIRUPRIFRPELQLQJVWDWHPHQWVHOVHZKHUHLQWKLVUHSRUW3URSULHWDU\ IXQGV SURYLGH WKH VDPH W\SH RI LQIRUPDWLRQ DV WKH JRYHUQPHQWZLGH ILQDQFLDOVWDWHPHQWVRQO\LQPRUHGHWDLO,QWHUQDOVHUYLFHIXQGV,QWHUQDOVHUYLFHIXQGVDUHXVHGDVDQDFFRXQWLQJGHYLFHWRDFFXPXODWHDQGDOORFDWHFRVWVLQWHUQDOO\DPRQJWKH&LW\¶VYDULRXVIXQFWLRQV7KH&LW\XWLOL]HVIRXULQWHUQDOVHUYLFHIXQGVWRDFFRXQWIRULQVXUDQFHDQGULVNPDQDJHPHQWDFWLYLWLHVHTXLSPHQWRSHUDWLRQV,7VHUYLFHV DQG IDFLOLWLHV PDQDJHPHQW7KHVH VHUYLFHV KDYH EHHQ DOORFDWHG SURSRUWLRQDWHO\ WRJRYHUQPHQWDODQGEXVLQHVVW\SHDFWLYLWLHVLQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV)LGXFLDU\ IXQGV)LGXFLDU\ IXQGV DUH XVHG WR DFFRXQWIRU UHVRXUFHV KHOG IRU WKHEHQHILW RISDUWLHV RXWVLGH WKH JRYHUQPHQW )LGXFLDU\ IXQGV DUH QRW UHIOHFWHG LQ WKH JRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVEHFDXVHWKHUHVRXUFHVRIWKRVHIXQGVDUHQRWDYDLODEOHWRVXSSRUWWKH&LW\¶VRZQSURJUDPV7KHDFFRXQWLQJXVHGIRUILGXFLDU\IXQGVLVPXFKOLNHWKDWXVHGIRUSURSULHWDU\IXQGV1RWHVWRWKHILQDQFLDOVWDWHPHQWV7KHQRWHVSURYLGHDGGLWLRQDOLQIRUPDWLRQWKDWLVHVVHQWLDOWRDIXOOXQGHUVWDQGLQJRIWKHGDWDSURYLGHGLQWKHJRYHUQPHQW±ZLGHDQGIXQGILQDQFLDOVWDWHPHQWV2WKHULQIRUPDWLRQ7KHFRPELQLQJDQGLQGLYLGXDOIXQGILQDQFLDOVWDWHPHQWVDQGVFKHGXOHVUHIHUUHGWRHDUOLHU LQ FRQQHFWLRQ ZLWK QRQPDMRU JRYHUQPHQWDO DQG HQWHUSULVH IXQGV DV ZHOO DV LQWHUQDO VHUYLFHIXQGV DUH SUHVHQWHG LPPHGLDWHO\ IROORZLQJ WKHUHTXLUHG VXSSOHPHQWDU\ LQIRUPDWLRQ 6XSSOHPHQWDU\ILQDQFLDOLQIRUPDWLRQDQGWKHVWDWLVWLFDOVHFWLRQDUHWKHILQDOWZRLWHPVSUHVHQWHG*29(510(17:,'(),1$1&,$/$1$/<6,6$VQRWHGHDUOLHUQHWSRVLWLRQPD\VHUYHRYHUWLPHDVDXVHIXOLQGLFDWRURIDJRYHUQPHQW¶VILQDQFLDOSRVLWLRQ,QWKHFDVHRIWKH&LW\DVVHWVDQGGHIHUUHGRXWIORZVRIUHVRXUFHVH[FHHGHGOLDELOLWLHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVE\ DWWKHFORVHRIWKHPRVWUHFHQWILVFDO\HDU&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 7KHODUJHVWSRUWLRQRIWKH&LW\¶VQHWSRVLWLRQ RU UHIOHFWVLWVLQYHVWPHQWLQFDSLWDODVVHWV HJODQGEXLOGLQJVPDFKLQHU\DQGHTXLSPHQW OHVVDQ\UHODWHGGHEWXVHGWRDFTXLUHWKRVHDVVHWV WKDW LV VWLOO RXWVWDQGLQJ 7KH &LW\ XVHV WKHVH FDSLWDO DVVHWV WR SURYLGH VHUYLFHV WR FLWL]HQV FRQVHTXHQWO\WKHVHDVVHWVDUHQRWDYDLODEOHIRUIXWXUHVSHQGLQJ$OWKRXJKWKH&LW\¶VLQYHVWPHQWLQLWVFDSLWDODVVHWVLVUHSRUWHGQHWRIUHODWHGGHEWLWVKRXOGEHQRWHGWKDWWKHUHVRXUFHVQHHGHGWRUHSD\WKLVGHEWPXVWEHSURYLGHGIURPRWKHUVRXUFHVVLQFHWKHFDSLWDODVVHWVWKHPVHOYHVFDQQRWEHXVHGWROLTXLGDWHWKHVHOLDELOLWLHV&LW\RI(GLQD¶V1HW3RVLWLRQ$VVHWV &XUUHQWDQG2WKHU$VVHWV &DSLWDO$VVHWV 7RWDO$VVHWV 'HIHUUHG2XWIORZVRI5HVRXUFHV 23(%3ODQ'HIHUPHQWV 3HQVLRQ3ODQ'HIHUPHQWV 7RWDO'HIHUUHG2XWIORZVRI5HVRXUFHV /LDELOLWLHV /RQJ7HUP/LDELOLWLHV2XWVWDQGLQJ 2WKHU/LDELOLWLHV 7RWDO/LDELOLWLHV 'HIHUUHG,QIORZVRI5HVRXUFHV 23(%3ODQ'HIHUPHQWV 3HQVLRQ3ODQ'HIHUPHQWV 7RWDO'HIHUUHG,QIORZVRI5HVRXUFHV 1HW3RVLWLRQ 1HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ *RYHUQPHQWDO$FWLYLWLHV%XVLQHVV7\SH$FWLYLWLHV7RWDO$ SRUWLRQ RIWKH &LW\¶VQHW SRVLWLRQ UHSUHVHQWVUHVRXUFHVWKDWDUHVXEMHFWWRH[WHUQDOUHVWULFWLRQVRQKRZWKH\PD\EHXVHG7KHUHPDLQLQJEDODQFHRIXQUHVWULFWHGQHWSRVLWLRQ PD\EHXVHGWRPHHWWKH&LW\¶VRQJRLQJREOLJDWLRQVWRFLWL]HQVDQGFUHGLWRUV$WWKHHQGRIWKHFXUUHQWILVFDO\HDUWKH&LW\LVDEOHWRUHSRUWSRVLWLYHEDODQFHVLQDOORIWKHFDWHJRULHVRIQHWSRVLWLRQUHSRUWHGERWKIRUWKHJRYHUQPHQWDVDZKROHDVZHOODVIRULWVVHSDUDWHJRYHUQPHQWDODQGEXVLQHVVW\SHDFWLYLWLHV7KHVDPHVLWXDWLRQKHOGWUXHIRUWKHSULRUILVFDO\HDU7KHUHZDVDGHFUHDVHRI LQXQUHVWULFWHGQHWSRVLWLRQ7KLVZDVPDLQO\GXHDWUDQVIHURIXQUHVWULFWHGJHQHUDOIXQGEDODQFHWRWKHFRQVWUXFWLRQIXQG7KHLQFUHDVHVLQGHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVUHODWHWRWKHFKDQJHVLQWKH&LW\¶VVKDUHRIVWDWHSHQVLRQSODQDPRXQWVZKLOHWKHGHFUHDVHLQORQJWHUPOLDELOLWLHVLVSULPDULO\DWWULEXWDEOHWRUHJXODUVFKHGXOHGSD\PHQWVRQWKH&LW\¶VRXWVWDQGLQJERQGVSDUWLDOO\RIIVHWE\QHZO\LVVXHGGHEWA-12 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 $V VKRZQ EHORZ WKH &LW\¶V QHW SRVLWLRQ LQFUHDVHG E\ GXULQJ WKH FXUUHQW ILVFDO \HDU)DFWRUVFRQWULEXWLQJWRWKLVFKDQJHDUHGLVFXVVHGLQWKHQH[WWZRVHFWLRQV&LW\RI(GLQD¶V&KDQJHVLQ1HW3RVLWLRQ5HYHQXHV 3URJUDP5HYHQXHV &KDUJHVIRU6HUYLFHV 2SHUDWLQJ*UDQWVDQG&RQWULEXWLRQV &DSLWDO*UDQWVDQG&RQWULEXWLRQV *HQHUDO5HYHQXHV 3URSHUW\7D[HV 2WKHU7D[HV *DLQRQ'LVSRVDORI$VVHWV 8QUHVWULFWHG,QYHVWPHQW(DUQLQJV 7RWDO5HYHQXHV ([SHQVHV *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV ,QWHUHVWRQ/RQJ7HUP'HEW :DWHU 6HZHU 6WRUPZDWHU 5HF\FOLQJ /LTXRU $TXDWLF&HQWHU*ROI&RXUVH$UHQD &RPPXQLW\$FWLYLW\&HQWHUV7RWDO([SHQVHV ,QFUHDVHLQ1HW3RVLWLRQ%HIRUH7UDQVIHUV 7UDQVIHUV &KDQJHLQ1HW3RVLWLRQ 1HW3RVLWLRQ-DQXDU\ 1HW3RVLWLRQ'HFHPEHU *RYHUQPHQWDO$FWLYLWLHV%XVLQHVV7\SH$FWLYLWLHV7RWDO*29(510(17$/$&7,9,7,(6*RYHUQPHQWDODFWLYLWLHVLQFUHDVHGWKH&LW\¶VQHWSRVLWLRQE\DFFRXQWLQJIRURIWKHWRWDOJURZWKLQQHWSRVLWLRQ.H\HOHPHQWVRIWKHLQFUHDVHDUHDVIROORZVx 3URSHUW\WD[HVLQFUHDVHGE\DVWKHUHVXOWRIDQLQFUHDVHGJHQHUDORSHUDWLQJOHY\WKDWSURYLGHVIXQGLQJWRFRQWLQXHH[LVWLQJVHUYLFHOHYHOVx 2WKHUWD[HVLQFUHDVHGE\GXHWRDQLQFUHDVHLQWD[LQFUHPHQWFROOHFWLRQVIURPWKH6RXWKGDOH3HQWDJRQ3DUNDQG*UDQGYLHZWD[LQFUHPHQWILQDQFLQJGLVWULFWVx ,QYHVWPHQWHDUQLQJVGHFUHDVHGE\ RULQGXHWRXQUHDOL]HGORVVHV&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 %HORZ DUH VSHFLILF JUDSKV ZKLFK SURYLGH FRPSDULVRQV RI WKH JRYHUQPHQWDO DFWLYLWLHVUHYHQXHV DQGH[SHQVHV &KDUJHVIRUVHUYLFHV2SHUDWLQJJUDQWVDQGFRQWULEXWLRQV&DSLWDOJUDQWVDQGFRQWULEXWLRQV3URSHUW\WD[HV2WKHUWD[HV2WKHU5HYHQXHVE\6RXUFH *RYHUQPHQWDO$FWLYLWLHV*HQHUDOJRYHUQPHQW3XEOLFVDIHW\ 3XEOLFZRUNV 3DUNV ,QWHUHVWRQORQJWHUPGHEW0LOOLRQV([SHQVHVDQG3URJUDP 5HYHQXHV *RYHUQPHQWDO$FWLYLWLHVH[SHQVHVSURJUDPUHYHQXHA-13 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 %86,1(667<3($&7,9,7,(6%XVLQHVVW\SHDFWLYLWLHVLQFUHDVHGQHWSRVLWLRQE\ DFFRXQWLQJIRURIWKH&LW\¶VJURZWKLQQHWSRVLWLRQ.H\HOHPHQWVRIWKHFXUUHQW\HDULQFUHDVHDUHDVIROORZV x 7KH XWLOLW\ IXQG KDG LQFRPH EHIRUH FRQWULEXWLRQV DQG WUDQVIHUV RI IRU 7KLVDGGLWLRQDOHTXLW\LVXVHGWRPDLQWDLQDQGLQYHVWLQWKHXWLOLW\LQIUDVWUXFWXUHDFFRUGLQJWRWKH&LW\¶V&,3DQGXWLOLW\UDWHVWXG\x 7KH OLTXRU IXQG KDG LQFRPH EHIRUH FRQWULEXWLRQV DQG WUDQVIHUVRI IRU 7KLVLQFRPHLVXVHGWRVXEVLGL]HRSHUDWLRQVDWRWKHUHQWHUSULVHIDFLOLWLHVx 7KHJROIFRXUVHKDGDQLQFRPHEHIRUHFRQWULEXWLRQVDQGWUDQVIHUVRI x 7KHRWKHUHQWHUSULVHIXQGVKDGDORVVEHIRUHFRQWULEXWLRQVDQGWUDQVIHUVRI LQWRWDO7KHVHHQWHUSULVHVKDGRSHUDWLQJH[SHQVHVWKDWH[FHHGHGUHYHQXHV&KDUJHVIRUVHUYLFHV &DSLWDOJUDQWVDQGFRQWULEXWLRQV8QUHVWULFWHGLQYHVWPHQWHDUQLQJV5HYHQXHVE\6RXUFH %XVLQHVVW\SH $FWLYLWLHV:DWHU 6HZHU 6WRUP 5HF\FOLQJ /LTXRU $TXDWLF *ROI $UHQD &RPPXQLW\0LOOLRQV([SHQVHVDQG3URJUDP 5HYHQXHV %XVLQHVVW\SH$FWLYLWLHVH[SHQVHVSURJUDPUHYHQXH&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 ),1$1&,$/$1$/<6,62)7+(&,7<¶6)81'6$VQRWHGHDUOLHUWKH&LW\XVHVIXQGDFFRXQWLQJWRHQVXUHDQGGHPRQVWUDWHFRPSOLDQFHZLWKILQDQFHUHODWHGOHJDOUHTXLUHPHQWV*RYHUQPHQWDOIXQGV7KHIRFXVRIWKH&LW\¶VJRYHUQPHQWDOIXQGVLVWRSURYLGHLQIRUPDWLRQRQQHDUWHUPLQIORZVRXWIORZVDQGEDODQFHVRIVSHQGDEOHUHVRXUFHV6XFKLQIRUPDWLRQLVXVHIXOLQDVVHVVLQJWKH &LW\¶V ILQDQFLQJ UHTXLUHPHQWV ,Q SDUWLFXODU XQDVVLJQHG IXQG EDODQFH PD\ VHUYH DV D XVHIXOPHDVXUHRIDJRYHUQPHQW¶VQHWUHVRXUFHVDYDLODEOHIRUVSHQGLQJDWWKHHQGRIWKHILVFDO\HDU$WWKHHQGRIWKHFXUUHQWILVFDO\HDUWKH&LW\¶VJRYHUQPHQWDOIXQGVUHSRUWHGFRPELQHGHQGLQJIXQGEDODQFHVRIDQLQFUHDVHRI LQFRPSDULVRQZLWKWKHSULRU\HDU$SSUR[LPDWHO\RIWKLVWRWDODPRXQW FRQVWLWXWHVXQDVVLJQHGIXQGEDODQFH7KHUHPDLQGHURIWKHIXQGEDODQFHLV UHVWULFWHGE\H[WHUQDOFUHGLWRUVJUDQWRUVODZVRUUHJXODWLRQV RU DVVLJQHGE\LQWHUQDOFRQVWUDLQWV RU QRQVSHQGDEOHLQWKHIRUPRISUHSDLGLWHPV 7KHJHQHUDOIXQGLVWKHFKLHIRSHUDWLQJIXQGRIWKH&LW\$WWKHHQGRIWKHFXUUHQWILVFDO\HDUXQDVVLJQHGIXQG EDODQFH RI WKH JHQHUDO IXQG ZDV $V D PHDVXUHRIWKHJHQHUDOIXQG¶VOLTXLGLW\XQDVVLJQHGIXQGEDODQFHUHSUHVHQWVRIWRWDOJHQHUDOIXQGH[SHQGLWXUHV7KHIXQGEDODQFHRIWKH&LW\¶VJHQHUDOIXQGGHFUHDVHGE\ GXULQJWKHFXUUHQWILVFDO\HDU.H\IDFWRUVUHODWHGWRWKLVLQFUHDVHLQFOXGH x 7RWDOJHQHUDOIXQGH[SHQGLWXUHVH[FHHGHGEXGJHWE\EXWUHYHQXHVZHUH RYHUEXGJHW7KLVLVGXHWRDQLQFUHDVHLQOLFHQVHVDQGSHUPLWVDVZHOODVLQWHUJRYHUQPHQWDOUHYHQXHUHODWHGWRIHGHUDOUHVSRQVHDQGUHFRYHU\IXQGLQJIRU&29,' x 7KHJHQHUDOIXQGWUDQVIHUUHGRIVXUSOXVSULPDULO\WRWKHFRQVWUXFWLRQIXQGIRUFDSLWDOSURMHFWV7KH+RXVLQJDQG5HGHYHORSPHQW$XWKRULW\IXQGEDODQFHLQFUHDVHGE\LQWKHFXUUHQWILVFDO\HDU GXH WR KLJKHU WKDQ DQWLFLSDWHG WD[ LQFUHPHQW FROOHFWLRQVOHVV VSHQW RQ FDSLWDO RXWOD\ WKDQDQWLFLSDWHGDQGERQGVLVVXHG7KHGHEWVHUYLFHIXQGKDVDWRWDOIXQGEDODQFHRI DOORIZKLFKLVUHVWULFWHGIRUWKHSD\PHQWRIGHEWVHUYLFH7KHQHWLQFUHDVHLQIXQGEDODQFHGXULQJWKHFXUUHQW\HDULQWKHGHEWVHUYLFHIXQGZDV)XQGEDODQFHLQFUHDVHGDVWKHUHVXOWRID WUDQVIHULQIURPWKHFRQVWUXFWLRQIXQGWR SD\ GHEW VHUYLFH 7KLV WUDQVIHU LV PDGH DQQXDOO\ ZLWK WKH DPRXQW YDU\LQJ VOLJKWO\ GHSHQGLQJ RQDYDLODEOHUHVRXUFHV7KH FRQVWUXFWLRQIXQG EDODQFH LQFUHDVHG E\ LQ GXH WR WUDQVIHUV LQ RI SULPDULO\IURPWKHJHQHUDOIXQGDVZHOODVERQGVLVVXHGA-14 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 3URSULHWDU\IXQGV7KH&LW\¶VSURSULHWDU\IXQGV SURYLGHWKH VDPHW\SHRILQIRUPDWLRQIRXQG LQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVEXWLQPRUHGHWDLO8QUHVWULFWHGQHWSRVLWLRQRIWKHXWLOLW\IXQGDWWKHHQGRIWKH\HDUDPRXQWHGWR7KHWRWDOJURZWKLQQHWSRVLWLRQIURPFXUUHQW\HDURSHUDWLRQVZDV 2SHUDWLQJUHYHQXHVLQWKHXWLOLWLHVIXQGLQFUHDVHGE\ZKLOHH[SHQVHVLQFUHDVHGE\LQ7KHUHYHQXHLQFUHDVHZDVGXHWRDQ LQFUHDVH LQ WKH ZDWHU VHZHU DQG VWRUP UDWHV DV ZHOO DV FRQQHFWLRQ IHHV LQ ([SHQVHVLQFUHDVHG EHFDXVH RI KLJKHU GHSUHFLDWLRQ H[SHQVHV UHODWHG WR LQIUDVWUXFWXUH SURMHFWV FRPSOHWHG LQUHFHQW\HDUVDQGKLJKHUSHUVRQDOVHUYLFHVH[SHQVHVIRURSHUDWLQJWKHXWLOLW\V\VWHP7KH&LW\LQYHVWHG LQXWLOLW\IXQGFDSLWDODVVHWVGXULQJDLQFUHDVHIURP8QUHVWULFWHGQHWSRVLWLRQRIWKHOLTXRUIXQGDWWKHHQGRIWKH\HDUDPRXQWHGWR 7RWDOQHWSRVLWLRQGHFUHDVHGE\7KHOLTXRUIXQGFRQWLQXHVWRWUDQVIHUSURILWVEDFNLQWRRWKHU&LW\IXQGVLQFOXGLQJWKHJHQHUDOIXQGFRQVWUXFWLRQDUHQDDQGDUWFHQWHUIXQGV7KHOLTXRUIXQGPDGHWUDQVIHUVWRWDOLQJWRWKHVHRWKHUIXQGVLQ7KHWUDQVIHUVRXWZHUHJUHDWHUWKDQRSHUDWLQJLQFRPHRI LQOHDGLQJWRWKHUHGXFWLRQLQQHWSRVLWLRQLQWKHOLTXRUIXQGLQ8QUHVWULFWHGQHWSRVLWLRQRIWKHDTXDWLFFHQWHUIXQGDWWKHHQGRIWKH\HDUDPRXQWHGWRZKLFKLVDLQFUHDVHRYHU7KH$TXDWLF&HQWHUZDVFORVHGIRUDOORIGXHWR&29,' UHVXOWLQJLQQRUHYHQXHDQGPLQLPDOH[SHQVHV8QUHVWULFWHG QHW SRVLWLRQ RI WKH JROI FRXUVH IXQG DW WKH HQG RI WKH \HDU DPRXQWHG WR D GHILFLW RI DQLPSURYHPHQWRIIURPWKHSULRU\HDU2SHUDWLQJLQFRPHIRUWKHJROIFRXUVHIXQGZDV LQFRPSDUHGWRDORVVRI LQDVLJQRILPSURYLQJSURILWDELOLW\8QUHVWULFWHGQHWSRVLWLRQRIWKHDUHQDIXQGDWWKHHQGRIWKH\HDUDPRXQWHGWRDGHILFLWRI DQLQFUHDVHLQWKHGHILFLWE\IURPWKHSULRU\HDU5HYHQXHVLQFUHDVHGE\ RYHUZKLOHH[SHQVHVLQFUHDVHGE\ 7KHRSHUDWLQJORVVIRUWKHDUHQDZDV IRUFRPSDUHGWR IRUGXULQJZKLFKWKHDUHQDZDVODUJHO\LPSDFWHGE\&29,' *(1(5$/)81'%8'*(7$5<+,*+/,*+76'XULQJ WKH \HDU UHYHQXHV ZHUH PRUH WKDQ EXGJHW DV WKH FRQWLQXHG FRPPHUFLDO DQGUHVLGHQWLDOUHGHYHORSPHQWRIWKH&LW\LQFUHDVHGRXUOLFHQVHVDQGSHUPLWVZKLFKH[FHHGHGEXGJHWE\DQGVXUSOXVHV LQVWDWHDQG IHGHUDODLG RI RYHUEXGJHW 7KHVHLQFUHDVHVRIIVHWGHILFLWVLQILQHVDQGIRUIHLWVDQGWD[UHYHQXHVZKLFKWRJHWKHUFDPHLQ XQGHUEXGJHW'XULQJWKH\HDUH[SHQGLWXUHVZHUHRYHUEXGJHWE\3XEOLFVDIHW\DQGJHQHUDOJRYHUQPHQWZHUHRYHUEXGJHWE\ ZKLFKZDVRIIVHWE\3XEOLF:RUNVDQG3DUNVFRPLQJLQXQGHUEXGJHWE\&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5(20) &$3,7$/$66(7$1''(%7$'0,1,675$7,21&DSLWDODVVHWVThe City’s investment in capital assets for its governmental and business-type activities as of December 31, 2021, amounted to $307,993,392 (net of accumulated depreciation). This investment in capital assets included land, land improvements, intangible assets such as easements, infrastructure assets (roads, bridges, sidewalks, and similar items), buildings, vehicles, equipment, parks, and construction in progress. The total increase in the City’s investment in capital assets for the current fiscal year was 1%. Major capital asset events during the current fiscal year included the following: x A variety of utility infrastructure improvements, including water main, sanitary and storm sewer, construction in progress as of the close of the fiscal year reached $12,562,430 in the utility fund. x The City spent $358,167 on a dehumidifier for the South Rink at Braemar Arena. x A variety of street construction, sidewalk and park projects; construction in progress as of the close of the fiscal year reached $9,042,909 (PIR + PACS). x The City has a number of public improvements underway in the Grandview district including rehabilitation of the Wooddale Ave Bridge and the Grandview Pedestrian Bridge, and parking and road improvements in the district. The construction in process cost was $2,730,354. &LW\RI(GLQD¶V&DSLWDO$VVHWV 1HWRI'HSUHFLDWLRQ 202120202021202020212020Land and Land Improvements27,965,567$30,114,062$ 10,295,102$ 10,552,207$38,260,669$40,666,269$ Easements253,000 253,000 35,600 35,600 288,600 288,600 Buildings and Structures34,130,177 35,375,635 15,516,491 17,449,027 49,646,668 52,824,662 Machinery and Equipment10,364,447 10,429,312.005,914,574 5,676,069 16,279,021 16,105,381 Infrastructure81,127,850 83,180,690 86,425,752 89,475,819 167,553,602 172,656,509 Parks10,767,1209,475,486 - - 10,767,1209,475,486 Construction in Progress12,491,0416,691,865 12,706,671 6,318,348 25,197,712 13,010,213 Total177,099,202$175,520,050$ 130,894,190$ 129,507,070$307,993,392$305,027,120$ Governmental ActivitiesBusiness-Type ActivitiesTotalAdditional information on the City’s capital assets can be found in Note 3. /RQJWHUP GHEWAt the end of the current fiscal year, the City had total bonded long-term debt outstanding of $110,308,000, an increase of $2,875,000 from 2020. $17,735,000 is for general obligation improvement debt that is supported by property tax levies and special assessments. $27,740,000 is for permanent improvement revolving (PIR) bonds, which finance the City’s street reconstruction program. This amount increased from 2020 due to newly issued debt. Also outstanding is $13,970,000 HRA public project revenue bonds which financed two gymnasiums, the new public works facility, sports dome, outdoor rink at the arena, and improvements to Pamela Park. This amount decreased from 2020 due to regularly scheduled principal payments. A-15 &,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 7KHUHLVDWRWDORILQUHYHQXHERQGVIRULPSURYHPHQWVWRWKHHQWHUSULVHIXQGV7KLVDPRXQWGHFUHDVHG GXULQJWKH\HDUGXHWRUHJXODUO\GHEWVHUYLFHSD\PHQWV&LW\RI(GLQD¶V2XWVWDQGLQJ'HEW*HQHUDO2EOLJDWLRQ%RQGV 3XEOLF,PSURYHPHQW%RQGV 3XEOLF3URMHFW5HYHQXH%RQGV 7D[,QFUHPHQW)LQDQFLQJ%RQGV5HYHQXH%RQGV 7RWDO *RYHUQPHQWDO$FWLYLWLHV%XVLQHVV7\SH$FWLYLWLHV7RWDO7KH&LW\PDLQWDLQVDQ$DDUDWLQJIURP0RRG\¶VDQGDQ$$$UDWLQJIURP6WDQGDUG 3RRU¶V6WDWHVWDWXWHVOLPLWWKHDPRXQWRIJHQHUDOREOLJDWLRQGHEWD0LQQHVRWDFLW\PD\LVVXHXSWRRIWRWDO(VWLPDWHG0DUNHW9DOXH7KHFXUUHQWGHEWOLPLWDWLRQIRUWKH&LW\LV2QO\RIWKH&LW\¶VRXWVWDQGLQJGHEWLVFRXQWHGZLWKLQWKHVWDWXWRU\OLPLWDWLRQ$GGLWLRQDOLQIRUPDWLRQRQWKH&LW\¶VORQJWHUPGHEWFDQEHIRXQGLQ1RWH(&2120,&)$&7256$1'1(;7<($5¶6%8'*(77KH&LW\VWULYHVWRSURYLGHDQXQFRPPRQO\KLJKTXDOLW\RIOLIHIRURXUUHVLGHQWVDQGEXVLQHVVHVDQGWKHUHODWLYHO\KHDOWK\ORFDOHFRQRP\KHOSVWRPDNHWKLVJRDODUHDOLW\7KHXQHPSOR\PHQWUDWHLQ(GLQDKDVUHPDLQHGXQGHU QRWVHDVRQDOO\DGMXVWHG VLQFHPLGZKLFKLVEHORZWKHVWDWHDQGQDWLRQDOOHYHOV7KH&LW\LVKRPHWR6RXWKGDOH&HQWHUWKHQDWLRQ¶VILUVWIXOO\HQFORVHGFOLPDWHFRQWUROOHGUHJLRQDOVKRSSLQJPDOO)DLUYLHZ6RXWKGDOHKRVSLWDODVZHOODVVHYHUDOFRUSRUDWHKHDGTXDUWHUV,QDGGLWLRQWRLWVKHDOWK\HFRQRP\(GLQDLVNQRZQIRUH[FHOOHQWSXEOLFVFKRROVDVWKH(GLQDVFKRROV\VWHPKDVEHHQFRQVLVWHQWO\VHOHFWHGDVRQHRIWKHEHVWLQWKHFRXQWU\1LQHW\HLJKWSHUFHQWRIVWXGHQWVJUDGXDWHZLWKHLJKW\QLQHSHUFHQWSXUVXLQJVRPHVRUWRISRVWVHFRQGDU\HGXFDWLRQ&,7<2)(',1$0,11(627$0$1$*(0(17¶6',6&866,21$1'$1$/<6,6<($5(1'(''(&(0%(5 3URSHUW\YDOXHVLQ(GLQDGHFUHDVHGIRUVHYHUDO\HDUVIURP DQGKDYHULVHQHDFK\HDUVLQFH(VWLPDWHGPDUNHWYDOXHRIUHDOHVWDWHLQFUHDVHGIRUWD[HVSD\DEOHLQ PDUNHWYDOXHLQ 0DUNHW9DOXHDQG7D[&DSDFLW\$QQXDO&KDQJHV7D[&DSDFLW\0DUNHW9DOXH7KH&LW\FROOHFWVSURSHUW\WD[HVEDVHGRQWD[FDSDFLW\ZKLFKURXJKO\HTXDOVHVWLPDWHGPDUNHWYDOXHPXOWLSOLHGE\FODVVUDWHVIRUGLIIHUHQWW\SHVRISDUFHOV FRPPHUFLDOUHVLGHQWLDOHWF &ODVVUDWHVDUHVHWE\VWDWHVWDWXWH7D[FDSDFLW\IRUUHDOHVWDWHLQFUHDVHGLQIRUWD[HVSD\DEOHLQDQGUHPDLQHGSRVLWLYHIRUWKHHLJKWKFRQVHFXWLYH\HDU$OOWKHVHIDFWRUVDERYHZHUHFRQVLGHUHGLQSUHSDULQJWKH&LW\¶VEXGJHWIRUWKHILVFDO\HDU7KH&LW\¶VDGRSWHGEXGJHWLQFOXGHVDSURSHUW\WD[OHY\RIIRUDOOIXQGVDQLQFUHDVHRI IURP WKH OHY\ ZLWK WKH LQFUHDVH EHLQJ DWWULEXWHG WR WKH LQWURGXFWLRQ RI WKH VWUHHWUHFRQVWUXFWLRQ OHY\ ZKLFK ZLOO HYHQWXDOO\ UHSODFH VSHFLDO DVVHVVPHQWVIRU URDG UHFRQVWUXFWLRQ 7KHLQFUHDVHG OHYLHV DUH DOVR IRU WKH &LW\¶V HTXLSPHQW UHSODFHPHQWH[SHQGLWXUHV +5$ RSHUDWLQJH[SHQGLWXUHVDQGJHQHUDORSHUDWLQJOHY\5(48(676)25,1)250$7,217KLVILQDQFLDOUHSRUWLVGHVLJQHGWRSURYLGHDJHQHUDORYHUYLHZRIWKH&LW\¶VILQDQFHVIRUDOOWKRVHZLWKDQLQWHUHVWLQWKHJRYHUQPHQW¶VILQDQFHV4XHVWLRQVFRQFHUQLQJDQ\RIWKHLQIRUPDWLRQSURYLGHGLQWKLVUHSRUWRUUHTXHVWVIRUDGGLWLRQDOILQDQFLDOLQIRUPDWLRQVKRXOGEHDGGUHVVHGWRWKH2IILFHRIWKH)LQDQFH'LUHFWRU:HVWWK6WUHHW(GLQD0LQQHVRWD7KH&LW\¶V$QQXDO&RPSUHKHQVLYH)LQDQFLDO5HSRUWFDQDOVREHIRXQGRQWKHLQWHUQHWDWZZZHGLQDPQJRYA-16 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ &,7<2)(',1$0,11(627$67$7(0(172)1(7326,7,21'(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV *RYHUQPHQWDO %XVLQHVV7\SH$FWLYLWLHV$FWLYLWLHV7RWDO$66(76&XUUHQW$VVHWV &DVKDQG,QYHVWPHQWV 5HVWULFWHG&DVKDQG,QYHVWPHQWV $FFUXHG,QWHUHVW $FFRXQWV5HFHLYDEOH1HW 6SHFLDO$VVHVVPHQWV5HFHLYDEOH ,QWHUQDOEDODQFHV 'XHIURP2WKHU*RYHUQPHQWV 3UHSDLG,WHPV ,QYHQWRU\ 7RWDO&XUUHQW$VVHWV 1RQFXUUHQW$VVHWV ,QYHVWPHQWLQ-RLQW3RZHUV$JUHHPHQW/RDQV5HFHLYDEOH 1RQGHSUHFLDEOH&DSLWDO$VVHWV 'HSUHFLDEOH&DSLWDO$VVHWV 1HW 7RWDO1RQFXUUHQW$VVHWV 7RWDO$VVHWV '()(55('287)/2:62)5(6285&(623(%3ODQ'HIHUPHQWV 'HILQHG%HQHILW3HQVLRQ3ODQV 7RWDO'HIHUUHG2XWIORZVRI5HVRXUFHV /,$%,/,7,(6&XUUHQW/LDELOLWLHV $FFRXQWV3D\DEOH 6DODULHV3D\DEOH $FFUXHG,QWHUHVW3D\DEOH&RQWUDFWV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 'HSRVLWV3D\DEOH8QHDUQHG5HYHQXH &RPSHQVDWHG$EVHQFHV3D\DEOH %RQGV3D\DEOH 7RWDO&XUUHQW/LDELOLWLHV 1RQFXUUHQW/LDELOLWLHV 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ &RPSHQVDWHG$EVHQFHV3D\DEOH %RQGVDQG/RDQV3D\DEOH1HW 7RWDO1RQFXUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV '()(55(',1)/2:62)5(6285&(623(%3ODQ'HIHUPHQWV 'HILQHG%HQHILW3HQVLRQ3ODQV 7RWDO'HIHUUHG,QIORZVRI5HVRXUFHV 1(7326,7,211HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHGIRU7D[,QFUHPHQWV 5HVWULFWHGIRU$IIRUGDEOH+RXVLQJ5HVWULFWHGIRU'HEW6HUYLFH 5HVWULFWHGIRU+LJKZD\&RQVWUXFWLRQ 5HVWULFWHGIRU&DSLWDO3URMHFWV 5HVWULFWHGIRU3DUNODQG'HGLFDWLRQ5HVWULFWHGIRU3ROLFH5HVWULFWHGIRU%UDHPDU*ROI'RQDWLRQV5HVWULFWHGIRU3HGHVWULDQDQG&\FOLVW,PSURYHPHQWV 5HVWULFWHGIRU&RQVHUYDWLRQDQG6XVWDLQDELOLW\,QLWLDWLYHV 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ 3ULPDU\*RYHUQPHQWA-17 &,7<2)(',1$0,11(627$67$7(0(172)$&7,9,7,(6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV 2SHUDWLQJ &DSLWDO&KDUJHVIRU *UDQWVDQG *UDQWVDQG *RYHUQPHQWDO %XVLQHVV7\SH([SHQVHV 6HUYLFHV &RQWULEXWLRQV &RQWULEXWLRQV $FWLYLWLHV $FWLYLWLHV 7RWDO)XQFWLRQV3URJUDPV3ULPDU\*RYHUQPHQW *RYHUQPHQWDO$FWLYLWLHV *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV ,QWHUHVWRQ/RQJ7HUP'HEW 7RWDO*RYHUQPHQW$FWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV :DWHU 6HZHU 6WRUPZDWHU 5HF\FOLQJ /LTXRU$TXDWLF&HQWHU *ROI&RXUVH $UHQD &RPPXQLW\$FWLYLW\&HQWHUV 7RWDO%XVLQHVV7\SH$FWLYLWLHV 7RWDO3ULPDU\*RYHUQPHQW *HQHUDO5HYHQXHV 3URSHUW\7D[HV 7D[,QFUHPHQW&ROOHFWLRQV )UDQFKLVH7D[HV /RGJLQJ7D[HV 8QUHVWULFWHG,QYHVWPHQW(DUQLQJV *DLQRQ'LVSRVDORI&DSLWDO$VVHWV7UDQVIHUV,QWHUQDO$FWLYLWLHV 7RWDO*HQHUDO5HYHQXHVDQG7UDQVIHUV &KDQJHLQ1HW3RVLWLRQ 1HW3RVLWLRQ%HJLQQLQJ 1HW3RVLWLRQ(QGLQJ 1HW ([SHQVH 5HYHQXHDQG&KDQJHVLQ1HW3RVLWLRQ3URJUDP5HYHQXHV&,7<2)(',1$0,11(627$%$/$1&(6+((7*29(510(17$/)81'6'(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV +RXVLQJDQG1RQPDMRU 7RWDO5HGHYHORSPHQW 'HEW*RYHUQPHQWDO*RYHUQPHQWDO*HQHUDO $XWKRULW\ 6HUYLFH &RQVWUXFWLRQ )XQGV )XQGV$66(76&DVKDQG,QYHVWPHQWV 5HVWULFWHG&DVKDQG,QYHVWPHQWV $FFUXHG,QWHUHVW $FFRXQWV5HFHLYDEOH 7D[HV5HFHLYDEOH 6SHFLDO$VVHVVPHQWV5HFHLYDEOH 'XHIURP2WKHU*RYHUQPHQWV 3UHSDLGLWHPV /RDQV5HFHLYDEOH 7RWDO$VVHWV /,$%,/,7,(6$FFRXQWV3D\DEOH 6DODULHV3D\DEOH &RQWUDFWV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 'HSRVLWV3D\DEOH 8QHDUQHG5HYHQXH 7RWDO/LDELOLWLHV '()(55(',1)/2:62)5(6285&(68QDYDLODEOH5HYHQXH7D[HV 8QDYDLODEOH5HYHQXH6SHFLDO$VVHVVPHQWV 8QDYDLODEOH5HYHQXH2WKHU 7RWDO'HIHUUHG,QIORZVRI5HVRXUFHV )81'%$/$1&(1RQVSHQGDEOH 5HVWULFWHG $VVLJQHG 8QDVVLJQHG 7RWDO)XQG%DODQFH 7RWDO/LDELOLWLHV'HIHUUHG,QIORZVRI5HVRXUFHVDQG)XQG%DODQFHV A-18 &,7<2)(',1$0,11(627$5(&21&,/,$7,212)7+(%$/$1&(6+((72)*29(510(17$/)81'6727+(67$7(0(172)1(7326,7,21'(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV 7RWDO)XQG%DODQFHV*RYHUQPHQWDO)XQGV$PRXQWVUHSRUWHGIRUJRYHUQPHQWDODFWLYLWLHVLQWKH6WDWHPHQWRI1HW3RVLWLRQDUHGLIIHUHQWEHFDXVH &DSLWDODVVHWVDUHLQFOXGHGLQQHWSRVLWLRQEXWDUHH[FOXGHGIURPIXQGEDODQFHVEHFDXVHWKH\GRQRWUHSUHVHQWILQDQFLDOUHVRXUFHV&RVWRI&DSLWDO$VVHWV$FFXPXODWHG'HSUHFLDWLRQ /RQJWHUPOLDELOLWLHVDUHLQFOXGHGLQQHWSRVLWLRQEXWDUHH[FOXGHGIURPIXQGEDODQFHVXQWLOGXHDQGSD\DEOH'HEWLVVXDQFHSUHPLXPVDQGGLVFRXQWVDUHH[FOXGHGIURPQHWSRVLWLRQXQWLODPRUWL]HGEXWDUHLQFOXGHGLQIXQGEDODQFHVXSRQLVVXDQFHDVRWKHUILQDQFLQJVRXUFHVDQGXVHV%RQGV3D\DEOH /RDQV3D\DEOH 3UHPLXPRQ%RQGV &RPSHQVDWHG$EVHQFHV3D\DEOH 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ $FFUXHGLQWHUHVWSD\DEOHRQORQJWHUPGHEWLVLQFOXGHGLQQHWSRVLWLRQEXWLVH[FOXGHGIURPIXQGEDODQFHVXQWLOGXHDQGSD\DEOH ,QYHVWPHQWLQMRLQWSRZHUVDJUHHPHQWDUHQRWDYDLODEOHWRSD\IRUFXUUHQWSHULRGH[SHQGLWXUHVDQGWKHUHIRUHDUHQRWUHSRUWHGLQWKHIXQGV7KHUHFRJQLWLRQRIFHUWDLQUHYHQXHVDQGH[SHQGLWXUHVGLIIHUEHWZHHQWKHIXOODFFUXDOJRYHUQPHQWDODFWLYLWLHVILQDQFLDOVWDWHPHQWVDQGWKHPRGLILHGDFFUXDOJRYHUQPHQWDOIXQGILQDQFLDOVWDWHPHQWV'HIHUUHG2XWIORZV23(%'HIHUUHG2XWIORZV3HQVLRQ 'HIHUUHG,QIORZV23(% 'HIHUUHG,QIORZV3HQVLRQ 'HIHUUHG,QIORZV3URSHUW\7D[HV'HIHUUHG,QIORZV6SHFLDO$VVHVVPHQWV'HIHUUHG,QIORZV2WKHU ,QWHUQDOVHUYLFHIXQGVDUHXVHGE\PDQDJHPHQWWRFKDUJHWKHFRVWVRIFHUWDLQDFWLYLWLHVWRLQGLYLGXDOIXQGV7KHDVVHWVDQGOLDELOLWLHVRIWKHLQWHUQDOVHUYLFHIXQGDUHLQFOXGHGLQWKHJRYHUQPHQWDODFWLYLWLHVLQWKHVWDWHPHQWRIQHWSRVLWLRQ 7RWDO1HW3RVLWLRQ*RYHUQPHQWDO$FWLYLWLHV&,7<2)(',1$0,11(627$67$7(0(172)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(*29(510(17$/)81'6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV +RXVLQJDQG1RQPDMRU 7RWDO5HGHYHORSPHQW 'HEW*RYHUQPHQWDO*RYHUQPHQWDO*HQHUDO $XWKRULW\ 6HUYLFH &RQVWUXFWLRQ )XQGV )XQGV5(9(18(6*HQHUDO3URSHUW\7D[HV 7D[,QFUHPHQW&ROOHFWLRQV )UDQFKLVH7D[HV /RGJLQJ7D[ 6SHFLDO$VVHVVPHQWV /LFHQVHDQG3HUPLWV ,QWHUJRYHUQPHQWDO &KDUJHVIRU6HUYLFHV )LQHVDQG)RUIHLWXUHV ,QYHVWPHQW,QFRPH /RVV 5HQWDORI3URSHUW\ 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV &DSLWDO2XWOD\ *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV &RPPXQLW\'HYHORSPHQW 'HEW6HUYLFH %RQG3ULQFLSDO ,QWHUHVWDQG)LVFDO&KDUJHV 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV,Q 7UDQVIHUV2XW 6DOHRI&DSLWDO$VVHWV %RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 A-19 &,7<2)(',1$0,11(627$5(&21&,/,$7,212)7+(67$7(0(172)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(62)*29(510(17$/)81'6727+(67$7(0(172)$&7,9,7,(6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV 7RWDO1HW&KDQJHLQ)XQG%DODQFHV*RYHUQPHQWDO)XQGV $PRXQWVUHSRUWHGIRUJRYHUQPHQWDODFWLYLWLHVLQWKH6WDWHPHQWRI$FWLYLWLHVDUHGLIIHUHQWEHFDXVH &DSLWDODVVHWVDUHUHFRUGHGLQQHWSRVLWLRQDQGWKHFRVWLVDOORFDWHGRYHUWKHLUHVWLPDWHGXVHIXOOLYHVDVGHSUHFLDWLRQH[SHQVH+RZHYHUIXQGEDODQFHVDUHUHGXFHGIRUWKHIXOOFRVWRIFDSLWDORXWOD\VDWWKHWLPHRISXUFKDVH&DSLWDO2XWOD\V'HSUHFLDWLRQ([SHQVH $JDLQRUORVVRQWKHGLVSRVDORIFDSLWDODVVHWVLQFOXGLQJWKHGLIIHUHQFHEHWZHHQWKHFDUU\LQJYDOXHDQGDQ\UHODWHGVDOHSURFHHGVLVLQFOXGHGLQWKHFKDQJHLQQHWSRVLWLRQ+RZHYHURQO\WKHVDOHSURFHHGVDQGLQVXUDQFHUHFRYHULHVDUHLQFOXGHGLQWKHFKDQJHLQIXQGEDODQFHV3URFHHGVIURPWKH6DOHRI&DSLWDO$VVHWV *DLQ /RVV RQWKH6DOHRI&DSLWDO$VVHWV5HYHQXHVLQWKHVWDWHPHQWRIDFWLYLWLHVWKDWGRQRWSURYLGHFXUUHQWILQDQFLDOUHVRXUFHV SURSHUW\WD[VSHFLDODVVHVVPHQWDQGRWKHUXQDYDLODEOHUHFHLYDEOHV DUHQRWUHSRUWHGDVUHYHQXHVLQWKHIXQGV 7KHDPRXQWRIGHEWLVVXHGSULQFLSDODVZHOODVDQ\LVVXDQFHSUHPLXPVRUGLVFRXQWVDUHUHSRUWHGLQWKHJRYHUQPHQWDOIXQGVDVDVRXUFHRIILQDQFLQJ'HEWREOLJDWLRQVDUHQRWUHYHQXHVLQWKH6WDWHPHQWRI$FWLYLWLHVEXWUDWKHUFRQVWLWXWHORQJWHUPOLDELOLWLHV 5HSD\PHQWRIORQJWHUPGHEWGRHVQRWDIIHFWWKHFKDQJHLQQHWSRVLWLRQ+RZHYHULWUHGXFHVIXQGEDODQFHV,QWHUHVWRQORQJWHUPGHEWLVLQFOXGHGLQWKHFKDQJHLQQHWSRVLWLRQDVLWDFFUXHVUHJDUGOHVVRIZKHQSD\PHQWLVGXH+RZHYHUWKH\DUHRQO\LQFOXGHGLQWKHFKDQJHLQIXQGEDODQFHVZKHQGXH 'HEWLVVXDQFHSUHPLXPVDQGGLVFRXQWVDUHLQFOXGHGLQWKHFKDQJHLQQHWSRVLWLRQDVWKH\DUHDPRUWL]HGRYHUWKHOLIHRIWKHGHEW$PRUWL]DWLRQIRUWKHFXUUHQW\HDULVLQFOXGHGLQLQWHUHVWH[SHQVHRQWKH6WDWHPHQWRI$FWLYLWLHV3HQVLRQDQG2WKHU3RVWHPSOR\PHQW%HQHILW 23(% H[SHQGLWXUHVLQWKHJRYHUQPHQWDOIXQGVDUHPHDVXUHGE\FXUUHQW\HDUHPSOR\HUFRQWULEXWLRQV3HQVLRQDQG23(%H[SHQVHVRQWKH6WDWHPHQWRI$FWLYLWLHVDUHPHDVXUHGE\WKHFKDQJHLQWKHQHWSHQVLRQOLDELOLW\WRWDO23(%OLDELOLW\DQGWKHUHODWHGGHIHUUHGLQIORZVDQGRXWIORZVRIUHVRXUFHV3HQVLRQ23(% ,QWKHJRYHUQPHQWDOIXQGVFRPSHQVDWHGDEVHQFHVH[SHQGLWXUHVDUHPHDVXUHGE\WKHDPRXQWRIILQDQFLDOUHVRXUFHVXVHG DPRXQWVDFWXDOO\SDLG ,QWKH6WDWHPHQWRI$FWLYLWLHVKRZHYHUFRPSHQVDWHGDEVHQFHVH[SHQVHVDUHPHDVXUHGE\WKHDPRXQWVHDUQHGGXULQJWKH\HDU&RPSHQVDWHG$EVHQFHV ,QWHUQDOVHUYLFHIXQGVDUHXVHGE\PDQDJHPHQWWRFKDUJHWKHFRVWVRIFHUWDLQDFWLYLWLHVWRLQGLYLGXDOIXQGV7KHFKDQJHLQQHWSRVLWLRQRIWKHLQWHUQDOVHUYLFHIXQGVLVLQFOXGHGLQWKHJRYHUQPHQWDODFWLYLWLHVLQWKH6WDWHPHQWRI$FWLYLWLHV&KDQJHLQ1HW3RVLWLRQ*RYHUQPHQWDO$FWLYLWLHV&,7<2)(',1$0,11(627$67$7(0(172)1(7326,7,2135235,(7$5<)81'6'(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV *RYHUQPHQWDO$FWLYLWLHV1RQPDMRU 7RWDO,QWHUQDO$TXDWLF *ROI(QWHUSULVH (QWHUSULVH 6HUYLFH8WLOLWLHV /LTXRU &HQWHU &RXUVH $UHQD )XQGV)XQGV)XQGV$66(76&XUUHQW$VVHWV &DVKDQG,QYHVWPHQWV 5HVWULFWHG&DVKDQG,QYHVWPHQWV ,QWHUHVW5HFHLYDEOH $FFRXQWV5HFHLYDEOH1HW 6SHFLDO$VVHVVPHQWV5HFHLYDEOH 'XHIURP2WKHU*RYHUQPHQWV3UHSDLG([SHQVHV ,QYHQWRU\ 7RWDO&XUUHQW$VVHWV 1RQFXUUHQW$VVHWV 1HW&DSLWDO$VVHWV 7RWDO$VVHWV '()(55('287)/2:62)5(6285&(623(%'HIHUUHG2XWIORZV 3HQVLRQ'HIHUUHG2XWIORZV 7RWDO'HIHUUHG2XWIORZVRI5HVRXUFHV /,$%,/,7,(6&XUUHQW/LDELOLWLHV $FFRXQWV3D\DEOH 6DODULHV3D\DEOH $FFUXHG,QWHUHVW3D\DEOH &RQWUDFWV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 8QHDUQHG5HYHQXH &RPSHQVDWHG$EVHQFHV3D\DEOH %RQGV3D\DEOH&XUUHQW 7RWDO&XUUHQW/LDELOLWLHV 1RQFXUUHQW/LDELOLWLHV 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ &RPSHQVDWHG$EVHQFHV3D\DEOH %RQGV3D\DEOH1HWRI8QDPRUWL]HG'LVFRXQWVDQG3UHPLXPV 7RWDO1RQFXUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV '()(55(',1)/2:62)5(6285&(623(%'HIHUUHG,QIORZV 3HQVLRQ'HIHUUHG,QIORZV 7RWDO'HIHUUHG,QIORZVRI5HVRXUFHV 7RWDO/LDELOLWLHVDQG'HIHUUHG,QIORZVRI5HVRXUFHV 1(7326,7,211HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHGIRU(GLQD/DZ'HEW 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ 1HWSRVLWLRQRIEXVLQHVVW\SHDFWLYLWLHV%XVLQHVV7\SH$FWLYLWLHV(QWHUSULVH)XQGV([SODQDWLRQRIGLIIHUHQWEHWZHHQ3URSULHWDU\)XQGV6WDWHPHQWRI5HYHQXH([SHQVHVDQG&KDQJHVLQ)XQG1HW3RVLWLRQDQGWKH6WDWHPHQWRI$FWLYLWLHV 7KH&LW\XVHVLQWHUQDOVHUYLFHIXQGVWRFKDUJHWKHFRVWRILWVULVNPDQDJHPHQWHTXLSPHQWRSHUDWLRQV,7DQGIDFLOLWLHVPDQDJHPHQWWRLQGLYLGXDOIXQGV7KLVDPRXQWUHSUHVHQWVWKHWRWDOLQFRPHWKDWKDVEHHQDOORFDWHGEDFNWRWKHEXVLQHVVW\SHDFWLYLWLHVLQWKHJRYHUQPHQWZLGH6WDWHPHQWRI$FWLYLWLHVWKDWLVDWWULEXWDEOHWRWKH&LW\ VEXVLQHVVW\SHDFWLYLWLHVHDFK\HDU A-20 &,7<2)(',1$0,11(627$67$7(0(172)5(9(18(6(;3(16(6$1'&+$1*(6,1)81'1(7326,7,2135235,(7$5<)81'6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV *RYHUQPHQWDO$FWLYLWLHV1RQPDMRU 7RWDO,QWHUQDO$TXDWLF*ROI(QWHUSULVH (QWHUSULVH 6HUYLFH8WLOLWLHV /LTXRU &HQWHU &RXUVH $UHQD )XQGV)XQGV)XQGV23(5$7,1*5(9(18(66DOHV/LTXRU 6DOHV5HWDLO 6DOHV8WLOLWLHV 6DOHV&RQFHVVLRQV 0HPEHUVKLSV $GPLVVLRQV /RGJLQJ7D[ %XLOGLQJ5HQWDO 5HQWDORI(TXLSPHQW *UHHQV)HHV 2WKHU)HHV 7RWDO2SHUDWLQJ5HYHQXHV 23(5$7,1*(;3(16(6&RVWRI6DOHVDQG6HUYLFHV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 'HSUHFLDWLRQ 7RWDO2SHUDWLQJ([SHQVHV 23(5$7,1*,1&20( /266 12123(5$7,1*5(9(18(6 (;3(16(6 ,QWHUJRYHUQPHQWDO ,QYHVWPHQW,QFRPH 'RQDWLRQV ,QWHUHVWDQG)LVFDO&KDUJHV $PRUWL]DWLRQRI%RQG3UHPLXPV 'LVFRXQWV *DLQ /RVV RQ6DOHRI&DSLWDO$VVHWV 0LVFHOODQHRXV 7RWDO1RQRSHUDWLQJ5HYHQXHV ([SHQVHV ,1&20( /266 %()25(75$16)(56 75$16)(567UDQVIHUV,Q 7UDQVIHUV2XW 7RWDO7UDQVIHUV &+$1*(,11(7326,7,21 1HW3RVLWLRQ-DQXDU\ 1(7326,7,21'(&(0%(5 &KDQJHLQQHWSRVLWLRQRIEXVLQHVVW\SHDFWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV(QWHUSULVH)XQGV([SODQDWLRQRIGLIIHUHQWEHWZHHQ3URSULHWDU\)XQGV6WDWHPHQWRI5HYHQXH([SHQVHVDQG&KDQJHVLQ)XQG1HW3RVLWLRQDQGWKH6WDWHPHQWRI$FWLYLWLHV 7KH&LW\XVHVLQWHUQDOVHUYLFHIXQGVWRFKDUJHWKHFRVWRILWVULVNPDQDJHPHQWHTXLSPHQWRSHUDWLRQV,7DQGIDFLOLWLHVPDQDJHPHQWWRLQGLYLGXDOIXQGV7KLVDPRXQWUHSUHVHQWVWKHLQFRPHWKDWKDVEHHQDOORFDWHGEDFNWRWKHEXVLQHVVW\SHDFWLYLWLHVLQWKHJRYHUQPHQWZLGH6WDWHPHQWRI$FWLYLWLHVWKDWLVDWWULEXWDEOHWRWKH&LW\ VEXVLQHVVW\SHDFWLYLWLHV &,7<2)(',1$0,11(627$67$7(0(172)&$6+)/2:635235,(7$5<)81'6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV *RYHUQPHQWDO$FWLYLWLHV1RQPDMRU 7RWDO,QWHUQDO$TXDWLF*ROI(QWHUSULVH (QWHUSULVH 6HUYLFH8WLOLWLHV /LTXRU &HQWHU &RXUVH $UHQD)XQGV)XQGV)XQGV&$6+)/2:6)52023(5$7,1*$&7,9,7,(65HFHLSWVIURP&XVWRPHUVDQG8VHUV 5HFHLSWVIURP&LW\)XQGV 3D\PHQWWR6XSSOLHUV 3D\PHQWWR(PSOR\HHV 1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV &$6+)/2:6)520121&$3,7$/),1$1&,1*$&7,9,7,(67UDQVIHUIURP2WKHU)XQGV 7UDQVIHUWR2WKHU)XQGV 1HW&DVK3URYLGHG 8VHG E\1RQFDSLWDO)LQDQFLQJ$FWLYLWLHV &$6+)/2:6)520&$3,7$/$1'5(/$7('),1$1&,1*$&7,9,7,(66WDWH*UDQW 3URFHHGVIURP&DSLWDO'HEW $FTXLVLWLRQRI&DSLWDO$VVHWV 3URFHHGVIURP'LVSRVDOVRI&DSLWDO$VVHWV 3ULQFLSDO3DLGRQ%RQGV ,QWHUHVWDQG)LVFDO&KDUJHV3DLGRQ%RQGV 1HW&DVK3URYLGHG 8VHG E\&DSLWDODQG5HODWHG)LQDQFLQJ$FWLYLWLHV &$6+)/2:6)520,19(67,1*$&7,9,7,(6,QWHUHVW5HFHLYHG 3XUFKDVHRI,QYHVWPHQWV 6DOHRI,QYHVWPHQWV 1HW&DVK)ORZV3URYLGHG 8VHG E\,QYHVWLQJ$FWLYLWLHV 1(7,1&5($6( '(&5($6( ,1&$6+ &DVK-DQXDU\ &$6+'(&(0%(5 &$6+$1',19(670(17635(6(17(',17+(67$7(0(172)1(7326,7,21&DVK ,QYHVWPHQWV 7RWDO&DVKDQG,QYHVWPHQWV %XVLQHVV7\SH$FWLYLWLHV(QWHUSULVH)XQGVA-21 &,7<2)(',1$0,11(627$67$7(0(172)&$6+)/2:6 &217,18(' 35235,(7$5<)81'6<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV *RYHUQPHQWDO$FWLYLWLHV5LVN1RQPDMRU 7RWDO0DQDJHPHQW$TXDWLF*ROI(QWHUSULVH (QWHUSULVH,QWHUQDO8WLOLWLHV /LTXRU &HQWHU &RXUVH $UHQD)XQGV)XQGV6HUYLFH)XQG5(&21&,/,$7,212)23(5$7,1*,1&20( /266 721(7&$6+3529,'(' 86(' %<23(5$7,1*$&7,9,7,(62SHUDWLQJ,QFRPH /RVV $GMXVWPHQWVWR5HFRQFLOH2SHUDWLQJ,QFRPH /RVV WR1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV 'HSUHFLDWLRQ 0LVFHOODQHRXV,QFRPH ,QFUHDVH 'HFUHDVHLQ $FFRXQWV5HFHLYDEOH 6SHFLDO$VVHVVPHQWV5HFHLYDEOH 'XHIURP2WKHU*RYHUQPHQWV ,QYHQWRU\ 3UHSDLG([SHQVHV 'HIHUUHG2XWIORZVRI5HVRXUFHV ,QFUHDVH 'HFUHDVH LQ $FFRXQWV3D\DEOH 6DODULHV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 8QHDUQHG5HYHQXH 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ &RPSHQVDWHG$EVHQFHV 'HIHUUHG,QIORZVRI5HVRXUFHV 7RWDO$GMXVWPHQWV 1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV 121&$6+,19(67,1*$&7,9,7,(6,QFUHDVHLQ)DLU9DOXHRI,QYHVWPHQWV 121&$6+&$3,7$/$1'5(/$7('),1$1&,1*$&7,9,7,(6$FTXLVLWLRQRI&DSLWDO$VVHWVZLWK&RQWUDFWV3D\DEOH &DSLWDO$VVHWV&RQWULEXWHG WR IURP2WKHU)XQGV%XVLQHVV7\SH$FWLYLWLHV(QWHUSULVH)XQGV&,7<2)(',1$0,11(627$67$7(0(172)),'8&,$5<1(7326,7,21$1'67$7(0(172)&+$1*(6,1),',&8$5,<1(7326,7,21&8672',$/)81'6'(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR)LQDQFLDO6WDWHPHQWV &XVWRGLDO)XQGV&DVKDQG,QYHVWPHQWV $FFRXQWV5HFHLYDEOH7RWDO$VVHWV$FFRXQWV3D\DEOH6DODULHV3D\DEOH 'XHWR2WKHU*RYHUQPHQWDO8QLWV8QHDUQHG5HYHQXH7RWDO/LDELOLWLHV 5HVWULFWHGIRU2UJDQL]DWLRQVDQG2WKHU*RYHUQPHQWV&ROOHFWLRQVRQ%HKDOIRI2WKHUV3D\PHQWVRQ%HKDOIRI2WKHUV 1HW,QFUHDVH 'HFUHDVH LQ)LGXFLDU\1HW3RVLWLRQ 1HW3RVLWLRQ%HJLQQLQJ1HW3RVLWLRQ(QGLQJ$66(76/,$%,/,7,(6$'',7,216'('8&7,2161(7326,7,21A-22 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(67KH &LW\ RI (GLQD WKH &LW\ ZDV LQFRUSRUDWHG LQ DQG RSHUDWHV XQGHU WKH VWDWH RI0LQQHVRWD6WDWXWRU\3ODQ%IRUPRI JRYHUQPHQW 7KH JRYHUQLQJ ERG\FRQVLVWVRIDILYHPHPEHU&LW\&RXQFLOHOHFWHGE\YRWHUVRIWKH&LW\7KH ILQDQFLDO VWDWHPHQWV RI WKH &LW\ KDYH EHHQ SUHSDUHG LQ FRQIRUPLW\ ZLWK DFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFDDVDSSOLHGWRJRYHUQPHQWDOXQLWV E\ WKH *RYHUQPHQWDO $FFRXQWLQJ 6WDQGDUGV %RDUG *$6% 7KH IROORZLQJ LV DVXPPDU\RIVLJQLILFDQWDFFRXQWLQJSROLFLHV$ )LQDQFLDO5HSRUWLQJ(QWLW\7KH &LW\¶V ILQDQFLDO UHSRUWLQJ HQWLW\FRQVLVWVRI D WKHSULPDU\ JRYHUQPHQW E RUJDQL]DWLRQV IRU ZKLFK WKH SULPDU\ JRYHUQPHQW LV ILQDQFLDOO\ DFFRXQWDEOH DQG F RWKHURUJDQL]DWLRQVIRUZKLFKWKHQDWXUHDQGVLJQLILFDQFHRIWKHLUUHODWLRQVKLSZLWKWKHSULPDU\JRYHUQPHQWDUHVXFKWKDWH[FOXVLRQZRXOGFDXVHWKHUHSRUWLQJHQWLW\¶VILQDQFLDOVWDWHPHQWV WR EH PLVOHDGLQJ RU LQFRPSOHWH 7KH SULPDU\ JRYHUQPHQW LV ILQDQFLDOO\DFFRXQWDEOHIRUWKHFRPSRQHQWXQLWLILWDSSRLQWVDYRWLQJPDMRULW\RIWKHFRPSRQHQWXQLW¶VJRYHUQLQJERG\DQGLVDEOHWRLPSRVHLWVZLOORQWKHFRPSRQHQWXQLWRUWKHUHLVDSRWHQWLDO IRU WKH FRPSRQHQW XQLW WR SURYLGH VSHFLILF ILQDQFLDOEHQHILWV WR RU LPSRVHVSHFLILFILQDQFLDOEXUGHQVRQWKHSULPDU\JRYHUQPHQW$VUHTXLUHGE\DFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFDWKHILQDQFLDOVWDWHPHQWVRIWKHUHSRUWLQJHQWLW\LQFOXGHWKRVHRIWKH&LW\RI(GLQD WKHSULPDU\JRYHUQPHQW DQGLWVFRPSRQHQWXQLWV7KHFRPSRQHQWXQLWGLVFXVVHGEHORZLVLQFOXGHGLQWKH&LW\¶VUHSRUWLQJHQWLW\EHFDXVHRIWKHVLJQLILFDQFHRILWVRSHUDWLRQDORUILQDQFLDOUHODWLRQVKLSVZLWKWKH&LW\&RPSRQHQW8QLW,Q FRQIRUPLW\ ZLWK DFFRXQWLQJ SULQFLSOHV JHQHUDOO\ DFFHSWHG LQWKH 8QLWHG 6WDWHV RI$PHULFD WKH ILQDQFLDO VWDWHPHQWV RI WKH FRPSRQHQW XQLW KDYH EHHQ LQFOXGHG LQ WKHILQDQFLDOUHSRUWLQJHQWLW\DVDEOHQGHGFRPSRQHQWXQLW7KH+RXVLQJDQG5HGHYHORSPHQW$XWKRULW\ +5$ LVDQHQWLW\OHJDOO\VHSDUDWHIURPWKH&LW\+RZHYHUIRUILQDQFLDOUHSRUWLQJSXUSRVHVWKH+5$LVUHSRUWHGDVLILWZHUHSDUWRIWKH&LW\¶VRSHUDWLRQVIRUWZRUHDVRQV)LUVWWKH+5$¶VJRYHUQLQJERG\LVVXEVWDQWLYHO\WKHVDPHDVWKHJRYHUQLQJERG\RIWKH&LW\6SHFLILFDOO\WKH+5$ERDUGFRQVLVWVRIILYHPHPEHUVDOORIZKLFKDUH&LW\&RXQFLOPHPEHUV6HFRQGPDQDJHPHQWRIWKH&LW\KDVRSHUDWLRQDOUHVSRQVLELOLW\IRUWKH+5$6SHFLILFDOO\VDOHVRIERQGVRURWKHUREOLJDWLRQVRIWKH+5$DUHDSSURYHGE\WKH&LW\&RXQFLO WKH+5$IROORZVWKHEXGJHWSURFHVVIRU&LW\GHSDUWPHQWVLQDFFRUGDQFHZLWK&LW\SROLF\ WKHDQQXDO+5$EXGJHWLVDSSURYHGE\&LW\&RXQFLO WKH+5$VXEPLWVLWVSODQIRUGHYHORSPHQWDQGUHGHYHORSPHQW WR WKH &LW\&RXQFLOIRUDSSURYDO ODVWO\WKHDGPLQLVWUDWLYHVWUXFWXUHDQGPDQDJHPHQWSUDFWLFHVDQGSROLFLHVRIWKH+5$DUHDSSURYHGE\WKH&LW\&RXQFLO7KHDFWLYLW\RIWKH+5$LVUHSRUWHGLQWKH6SHFLDO5HYHQXH)XQGV6HSDUDWHILQDQFLDOVWDWHPHQWVDUHQRWSUHSDUHGIRUWKH+5$&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' % *RYHUQPHQW:LGHDQG)XQG)LQDQFLDO6WDWHPHQWV7KHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV LHWKHVWDWHPHQWRIQHWSRVLWLRQDQGWKHVWDWHPHQWRIDFWLYLWLHV UHSRUWLQIRUPDWLRQRQDOORIWKHQRQILGXFLDU\DFWLYLWLHVRIWKH&LW\*RYHUQPHQWDODFWLYLWLHVZKLFKQRUPDOO\DUHVXSSRUWHGE\WD[HVDQGLQWHUJRYHUQPHQWDOUHYHQXHV DUH UHSRUWHG VHSDUDWHO\ IURPEXVLQHVVW\SH DFWLYLWLHV ZKLFK UHO\ WR DVLJQLILFDQWH[WHQWRQIHHVDQGFKDUJHVIRUVXSSRUW7KHVWDWHPHQWRIDFWLYLWLHVGHPRQVWUDWHVWKHGHJUHHWRZKLFKWKHGLUHFWH[SHQVHVRIDJLYHQIXQFWLRQRUEXVLQHVVW\SHDFWLYLW\DUHRIIVHWE\SURJUDPUHYHQXHV'LUHFWH[SHQVHVDUHWKRVHWKDWDUHFOHDUO\LGHQWLILDEOHZLWKDVSHFLILFIXQFWLRQRUEXVLQHVVW\SHDFWLYLW\3URJUDPUHYHQXHVLQFOXGH FKDUJHVWRFXVWRPHUVRUDSSOLFDQWVZKRSXUFKDVHXVHRUGLUHFWO\ EHQHILW IURP JRRGV VHUYLFHV RU SULYLOHJHV SURYLGHG E\ D JLYHQ IXQFWLRQ RUEXVLQHVVW\SHDFWLYLW\DQG JUDQWVDQGFRQWULEXWLRQVWKDWDUHUHVWULFWHGWRPHHWLQJWKHRSHUDWLRQDO RU FDSLWDO UHTXLUHPHQWV RI D SDUWLFXODU IXQFWLRQ RUEXVLQHVVW\SHDFWLYLW\7D[HVDQGRWKHULWHPVQRWLQFOXGHGDPRQJSURJUDPUHYHQXHVDUHUHSRUWHGLQVWHDGDVJHQHUDOUHYHQXHV6HSDUDWHILQDQFLDOVWDWHPHQWVDUHSURYLGHGIRUJRYHUQPHQWDOIXQGVSURSULHWDU\IXQGVDQG ILGXFLDU\ IXQGV HYHQ WKRXJK WKH ODWWHU DUH H[FOXGHG IURP WKH JRYHUQPHQWZLGHILQDQFLDO VWDWHPHQWV 0DMRU LQGLYLGXDO JRYHUQPHQWDO IXQGV DQG PDMRU LQGLYLGXDOHQWHUSULVH IXQGV DUH UHSRUWHG DV VHSDUDWH FROXPQV LQ WKH IXQG ILQDQFLDO VWDWHPHQWV$JJUHJDWHGLQIRUPDWLRQIRUWKHUHPDLQLQJQRQPDMRUJRYHUQPHQWDODQGHQWHUSULVHIXQGVLVUHSRUWHGLQDVLQJOHFROXPQLQWKHIXQGILQDQFLDOVWDWHPHQWV& 0HDVXUHPHQW)RFXV%DVLVRI$FFRXQWLQJDQG)LQDQFLDO6WDWHPHQW3UHVHQWDWLRQ7KHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVDUHUHSRUWHGXVLQJWKHHFRQRPLFUHVRXUFHVPHDVXUHPHQWIRFXVDQGWKHDFFUXDOEDVLVRIDFFRXQWLQJDVDUHWKHSURSULHWDU\IXQGDQGILGXFLDU\IXQGILQDQFLDOVWDWHPHQWV7KH&LW\¶VRQO\ILGXFLDU\IXQGW\SHFXVWRGLDOIXQGVDUHFXVWRGLDOLQQDWXUHDQGGRQRWKDYHDPHDVXUHPHQWIRFXV5HYHQXHVDUHUHFRUGHGZKHQHDUQHGDQGH[SHQVHVDUHUHFRUGHGZKHQDOLDELOLW\LVLQFXUUHGUHJDUGOHVVRIWKHWLPLQJRIUHODWHGFDVKIORZV3URSHUW\WD[HVDUHUHFRJQL]HGDVUHYHQXHVLQWKH\HDUIRUZKLFKWKH\DUHOHYLHG*UDQWVDQGVLPLODULWHPVDUHUHFRJQL]HGDVUHYHQXHDVVRRQDVDOOHOLJLELOLW\UHTXLUHPHQWVLPSRVHGE\WKHSURYLGHUKDYHEHHQPHW*RYHUQPHQWDO IXQG ILQDQFLDO VWDWHPHQWV DUH UHSRUWHG XVLQJ WKHFXUUHQW ILQDQFLDOUHVRXUFHVPHDVXUHPHQWIRFXVDQGWKHPRGLILHGDFFUXDOEDVLVRIDFFRXQWLQJ5HYHQXHVDUH UHFRJQL]HG DV VRRQ DV WKH\ DUH ERWK PHDVXUDEOH DQG DYDLODEOH 5HYHQXHV DUHFRQVLGHUHGWREHDYDLODEOHZKHQWKH\DUHFROOHFWLEOHZLWKLQWKHFXUUHQWSHULRGRUVRRQHQRXJK WKHUHDIWHU WR SD\ OLDELOLWLHV RI WKH FXUUHQW SHULRG )RU WKLV SXUSRVH WKH &LW\FRQVLGHUV DOO UHYHQXHV H[FHSW UHLPEXUVHPHQW JUDQWV WR EH DYDLODEOH LI WKH\ DUHFROOHFWHGZLWKLQGD\VRIWKHHQGRIWKHFXUUHQWILVFDOSHULRG([SHQGLWXUHVJHQHUDOO\DUHUHFRUGHGZKHQDOLDELOLW\LVLQFXUUHGDVXQGHUDFFUXDODFFRXQWLQJ+RZHYHUGHEWVHUYLFHH[SHQGLWXUHVDVZHOODVH[SHQGLWXUHVUHODWHGWRFRPSHQVDWHGDEVHQFHVRWKHUSRVWHPSOR\PHQWEHQHILWV 23(% QHWSHQVLRQOLDELOLWLHVDQGFODLPVDQGMXGJPHQWVDUHUHFRUGHGRQO\ZKHQSD\PHQWLVGXHA-23 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' & 0HDVXUHPHQW)RFXV%DVLVRI$FFRXQWLQJDQG)LQDQFLDO6WDWHPHQW3UHVHQWDWLRQ &RQWLQXHG 3URSHUW\WD[HVVSHFLDODVVHVVPHQWVLQWHUJRYHUQPHQWDOUHYHQXHVFKDUJHVIRUVHUYLFHVDQGLQWHUHVWDVVRFLDWHGZLWKWKHFXUUHQWILVFDOSHULRGDUHDOOFRQVLGHUHGWREHVXVFHSWLEOHWRDFFUXDODQGVRKDYHEHHQUHFRJQL]HGDVUHYHQXHVRIWKHFXUUHQWILVFDOSHULRG2QO\WKH SRUWLRQ RI VSHFLDO DVVHVVPHQWV UHFHLYDEOH GXH ZLWKLQ WKH FXUUHQW ILVFDO SHULRG LVFRQVLGHUHG WR EH VXVFHSWLEOH WR DFFUXDO DV UHYHQXH RI WKH FXUUHQW SHULRG $OO RWKHUUHYHQXH LWHPV DUH FRQVLGHUHG WR EH PHDVXUDEOH DQG DYDLODEOH RQO\ ZKHQ FDVK LVUHFHLYHGE\WKH&LW\7KH&LW\UHSRUWVWKHIROORZLQJPDMRUJRYHUQPHQWDOIXQGV 7KH JHQHUDO IXQGLV WKH JRYHUQPHQW¶V SULPDU\ RSHUDWLQJ IXQG ,W DFFRXQWV IRU DOOILQDQFLDO UHVRXUFHV RI WKH JHQHUDO JRYHUQPHQW H[FHSW WKRVH UHTXLUHG WR EHDFFRXQWHGIRULQDQRWKHUIXQG7KHVSHFLDOUHYHQXH+RXVLQJDQG5HGHYHORSPHQW$XWKRULW\IXQGLVXVHGWRDFFRXQWIRU UHYHQXHV IURP VHYHUDO VRXUFHV SURSHUW\ WD[HV ERQG SURFHHGV LQYHVWPHQWHDUQLQJVHWF WKDWDUHUHVWULFWHGIRUKRXVLQJDQGUHGHYHORSPHQW7KHGHEWVHUYLFHIXQGDFFRXQWVIRUWKHSD\PHQWRISULQFLSDODQGLQWHUHVWRQ*HQHUDO2EOLJDWLRQ3HUPDQHQW,PSURYHPHQW5HYROYLQJ3XEOLF3URMHFW5HYHQXH%RQGVDQG(GLQD(PHUDOG(QHUJ\3URJUDP%RQGV7KHFDSLWDOSURMHFWVFRQVWUXFWLRQIXQGDFFRXQWVIRUWKHYDULRXVVSHFLDODVVHVVPHQWDQG VWDWH DLG SURMHFWV WKURXJKRXW WKH &LW\ 7KLV IXQG DOVR SURYLGHV ILQDQFLQJ IRUFDSLWDOLPSURYHPHQWVDVUHVWULFWHGLQWKH&LW\¶VFDSLWDOLPSURYHPHQWEXGJHW7KH&LW\UHSRUWVWKHIROORZLQJPDMRUSURSULHWDU\IXQGV 7KHXWLOLWLHVIXQGDFFRXQWVIRUWKHSURYLVLRQRIZDWHUVHZHUVWRUPDQGUHF\FOLQJVHUYLFHVWRWKH&LW\¶VUHVLGHQWV7KHOLTXRUIXQGDFFRXQWVIRUWKHRSHUDWLRQRIWKH&LW\¶VWKUHHOLTXRUVWRUHV7KHDTXDWLFFHQWHUIXQGDFFRXQWVIRUWKHRSHUDWLRQRIWKH&LW\¶VDTXDWLFFHQWHU7KHJROIFRXUVHIXQGDFFRXQWVIRUWKHRSHUDWLRQRIWKH&LW\¶VWZRJROIFRXUVHVDQGDJROIGRPH7KHDUHQDIXQGDFFRXQWVIRUWKHRSHUDWLRQRIWKH&LW\¶VLFHDUHQD&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' & 0HDVXUHPHQW)RFXV%DVLVRI$FFRXQWLQJDQG)LQDQFLDO6WDWHPHQW3UHVHQWDWLRQ &RQWLQXHG $GGLWLRQDOO\WKH&LW\UHSRUWVWKHIROORZLQJIXQGW\SHV ,QWHUQDOVHUYLFHIXQGV±WKHULVNPDQDJHPHQWHTXLSPHQWRSHUDWLRQVLQIRUPDWLRQWHFKQRORJ\DQGIDFLOLWLHVPDQDJHPHQW LQWHUQDOVHUYLFHIXQGVDFFRXQWIRU FRVWVRILQVXUDQFHDQGULVNPDQDJHPHQWSURJUDPVHTXLSPHQWRSHUDWLRQV,7VHUYLFHVDQGIDFLOLWLHV PDQDJHPHQW DFURVV DOO PXQLFLSDO GHSDUWPHQWV ,QWHUQDO VHUYLFH IXQGVRSHUDWH LQ D PDQQHU VLPLODU WR HQWHUSULVH IXQGV KRZHYHU LW SURYLGHV VHUYLFHVSULPDULO\WRRWKHUGHSDUWPHQWVZLWKLQWKH&LW\&XVWRGLDOIXQGV±WKHSROLFHVHL]XUH3XEOLF6DIHW\7UDLQLQJ)DFLOLW\DQG0LQQHVRWD7DVN)RUFHIXQGVDFFRXQWIRUIHHVFROOHFWHGIRURWKHUJRYHUQPHQWDJHQFLHV$VDJHQHUDOUXOHWKHHIIHFWRILQWHUIXQGDFWLYLW\KDVEHHQHOLPLQDWHG IURP WKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV([FHSWLRQVWRWKLVJHQHUDOUXOHDUHWUDQVDFWLRQVWKDWZRXOGEHWUHDWHGDVUHYHQXHVH[SHQGLWXUHVRUH[SHQVHVLIWKH\LQYROYHGH[WHUQDORUJDQL]DWLRQV VXFK DVEX\LQJ JRRGV DQG VHUYLFHV RU SD\PHQWV LQ OLHX RI WD[HV DUHVLPLODUO\WUHDWHGZKHQWKH\LQYROYHRWKHUIXQGVRIWKH&LW\RI(GLQD(OLPLQDWLRQRIWKHVHFKDUJHVZRXOGGLVWRUWWKHGLUHFWFRVWVDQGSURJUDPUHYHQXHVUHSRUWHGIRUWKHYDULRXVIXQFWLRQVFRQFHUQHG$PRXQWVUHSRUWHGDVSURJUDPUHYHQXHVLQFOXGH FKDUJHVWRFXVWRPHUVRUDSSOLFDQWVIRUJRRGVVHUYLFHVRUSULYLOHJHVSURYLGHG RSHUDWLQJJUDQWVDQGFRQWULEXWLRQVDQG FDSLWDOJUDQWVDQGFRQWULEXWLRQVLQFOXGLQJVSHFLDODVVHVVPHQWV,QWHUQDOO\GHGLFDWHGUHVRXUFHVDUHUHSRUWHGDVJHQHUDOUHYHQXHVUDWKHUWKDQDVSURJUDPUHYHQXHV/LNHZLVHJHQHUDOUHYHQXHVLQFOXGHDOOWD[HV3URSULHWDU\ IXQGV GLVWLQJXLVKRSHUDWLQJUHYHQXHV DQG H[SHQVHV IURPQRQRSHUDWLQJLWHPV2SHUDWLQJUHYHQXHVDQGH[SHQVHVJHQHUDOO\UHVXOWIURPSURYLGLQJVHUYLFHVDQGSURGXFLQJDQGGHOLYHULQJJRRGVLQFRQQHFWLRQZLWKDSURSULHWDU\IXQG¶VSULQFLSDORQJRLQJRSHUDWLRQV7KHSULQFLSDORSHUDWLQJUHYHQXHVRIWKH&LW\¶VHQWHUSULVHIXQGVDQGLQWHUQDOVHUYLFHIXQGDUHFKDUJHVWRFXVWRPHUVIRUVDOHVDQGVHUYLFHV2SHUDWLQJH[SHQVHVIRUWKHHQWHUSULVHIXQGVDQGLQWHUQDOVHUYLFHIXQGLQFOXGHWKHFRVWRIVDOHVDQGVHUYLFHVDGPLQLVWUDWLYHH[SHQVHVDQGGHSUHFLDWLRQRQFDSLWDODVVHWV$OOUHYHQXHVDQGH[SHQVHVQRWPHHWLQJWKLVGHILQLWLRQDUHUHSRUWHGDVQRQRSHUDWLQJUHYHQXHVDQGH[SHQVHV$JJUHJDWHGLQIRUPDWLRQIRUWKHLQWHUQDOVHUYLFHIXQGVLVUHSRUWHGLQDVLQJOHFROXPQLQWKHSURSULHWDU\ IXQG ILQDQFLDO VWDWHPHQWV 7KHVH VHUYLFHV KDYH EHHQ DOORFDWHGSURSRUWLRQDWHO\ WR JRYHUQPHQWDO DQG EXVLQHVVW\SH DFWLYLWLHV LQ WKH JRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV7KHFRVWRIWKHVHVHUYLFHVLVUHSRUWHGLQWKHDSSURSULDWHIXQFWLRQDODFWLYLW\'HSUHFLDWLRQH[SHQVHLVLQFOXGHGLQWKHGLUHFWH[SHQVHVRIHDFKIXQFWLRQ,QWHUHVWRQORQJWHUP GHEW LV FRQVLGHUHG DQ LQGLUHFW H[SHQVH DQG LV UHSRUWHG VHSDUDWHO\ RQ WKHVWDWHPHQWRIDFWLYLWLHVA-24 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' ' &DVKDQG,QYHVWPHQWV&DVKDQG,QYHVWPHQWV7KHFDVKEDODQFHVRIWKH&LW\DQGLWVFRPSRQHQWXQLWDUHSRROHGDQGLQYHVWHGIRUWKHSXUSRVHRILQFUHDVLQJHDUQLQJVWKURXJKLQYHVWPHQWDFWLYLWLHV7KHSRRO¶VLQYHVWPHQWVDUHUHSRUWHGDWIDLUYDOXHDW\HDUHQGH[FHSWIRULQYHVWPHQWVLQH[WHUQDOLQYHVWPHQWSRROVZKLFK DUH VWDWHG DW DPRUWL]HG FRVW 7KH &LW\ KDV WKH DELOLW\ DQG LQWHQW WR KROG LWVLQYHVWPHQWV WR PDWXULW\ 7KH LQGLYLGXDO IXQGV¶ SRUWLRQV RI WKHSRRO¶V IDLU YDOXH DUHSUHVHQWHGDV³&DVKDQGLQYHVWPHQWV´(DUQLQJVIURPVXFKLQYHVWPHQWVDUHDOORFDWHGWRWKHUHVSHFWLYHIXQGVRQWKHEDVLVRIDSSOLFDEOHFDVKEDODQFHSDUWLFLSDWLRQE\HDFKIXQG7KH &LW\ SURYLGHV WHPSRUDU\ DGYDQFHV WR IXQGV WKDW KDYH LQVXIILFLHQW FDVK DQGLQYHVWPHQWEDODQFHVE\PHDQVRIDQDGYDQFHIURPDQRWKHUIXQGVKRZQDVLQWHUIXQGUHFHLYDEOHVLQWKHDGYDQFLQJIXQGDQGDQLQWHUIXQGSD\DEOHLQWKHIXQGZLWKWKHGHILFLWXQWLODGHTXDWHUHVRXUFHVDUHUHFHLYHG7KHVHLQWHUIXQGEDODQFHVDUHHOLPLQDWHGRQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV7KH &LW\ FDWHJRUL]HV LWV IDLU YDOXH PHDVXUHPHQWV ZLWKLQ WKH IDLU YDOXH KLHUDUFK\HVWDEOLVKHGE\DFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD7KHKLHUDUFK\LVEDVHGRQWKHYDOXDWLRQLQSXWVXVHGWRPHDVXUHWKHIDLUYDOXHRIWKHDVVHW/HYHOLQSXWVDUHTXRWHGSULFHVLQDFWLYHPDUNHWVIRULGHQWLFDODVVHWV /HYHOLQSXWVDUHVLJQLILFDQWRWKHUREVHUYDEOHLQSXWV /HYHOLQSXWVDUHVLJQLILFDQWXQREVHUYDEOHLQSXWV'HEW VHFXULWLHV FODVVLILHG LQ /HYHO RI WKH IDLU YDOXH KLHUDUFK\ DUH YDOXHG XVLQJHYDOXDWLRQVEDVHGRQYDULRXVPDUNHWDQGLQGXVWU\LQSXWV6HH1RWHIRUWKH&LW\¶VUHFXUULQJIDLUYDOXHPHDVXUHPHQWVDVRIWKHFXUUHQW\HDUHQG5HVWULFWHG&DVKDQG,QYHVWPHQWV5HVWULFWHGFDVKDQGLQYHVWPHQWVUHSUHVHQWERQGSURFHHGVKHOGIRUVSHFLILFSXUSRVHV(DUQLQJVRQWKHVHLQYHVWPHQWVDUHDOORFDWHGGLUHFWO\WRWKHVHIXQGV&DVK(TXLYDOHQWV)RUWKHSXUSRVHVRIWKHVWDWHPHQWRIFDVKIORZVWKH&LW\FRQVLGHUVDOOKLJKO\OLTXLGGHEWLQVWUXPHQWV ZLWK DQ RULJLQDO PDWXULW\ IURP WKH WLPH RI SXUFKDVH E\ WKH &LW\ RI WKUHHPRQWKVRUOHVVWREHFDVKHTXLYDOHQWV7KHSURSULHWDU\IXQGV¶SRUWLRQLQWKHJRYHUQPHQWZLGHFDVKDQGLQYHVWPHQWPDQDJHPHQWSRROLVFRQVLGHUHGWREHFDVKHTXLYDOHQW&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' ( 5HFHLYDEOHVDQG3D\DEOHV'XULQJWKHFRXUVHRIRSHUDWLRQVQXPHURXVWUDQVDFWLRQVRFFXUEHWZHHQLQGLYLGXDOIXQGVIRUJRRGVSURYLGHGRUVHUYLFHVUHQGHUHG6KRUWWHUPLQWHUIXQGORDQVDUHFODVVLILHGDV³GXH WRIURP RWKHU IXQGV´ $OO VKRUWWHUP LQWHUIXQG UHFHLYDEOHV DQG SD\DEOHV DW'HFHPEHU DUH SODQQHG WR EH HOLPLQDWHG LQ $Q\ UHVLGXDO EDODQFHVRXWVWDQGLQJ EHWZHHQ WKH JRYHUQPHQWDO DFWLYLWLHV DQG EXVLQHVVW\SH DFWLYLWLHV DUHUHSRUWHGLQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWVDV³LQWHUQDOEDODQFHV´3URSHUW\ WD[HV DQG VSHFLDO DVVHVVPHQWV UHFHLYDEOHV KDYH EHHQ UHSRUWHG QHW RIHVWLPDWHGXQFROOHFWLEOHDFFRXQWV%HFDXVHXWLOLW\ELOOVDUHFRQVLGHUHGOLHQVRQSURSHUW\QR HVWLPDWHG XQFROOHFWLEOH DPRXQWV DUH HVWDEOLVKHG 8QFROOHFWLEOH DPRXQWV DUH QRWPDWHULDOIRURWKHUUHFHLYDEOHVDQGKDYHQRWEHHQUHSRUWHG) 5HYHQXH5HFRJQLWLRQ 3URSHUW\7D[5HYHQXH5HFRJQLWLRQ7KH &LW\ &RXQFLO DQQXDOO\ DGRSWV D WD[ OHY\ DQG FHUWLILHV LW WR WKH &RXQW\ LQ'HFHPEHU OHY\DVVHVVPHQWGDWH RIHDFK\HDUIRUFROOHFWLRQLQWKHIROORZLQJ\HDU7KH&RXQW\LVUHVSRQVLEOHIRUELOOLQJDQGFROOHFWLQJDOOSURSHUW\WD[HVIRULWVHOIWKH&LW\WKHORFDO6FKRRO'LVWULFWDQGRWKHUWD[LQJDXWKRULWLHV6XFKWD[HVEHFRPHDOLHQRQ-DQXDU\DQGDUHUHFRUGHGDVUHFHLYDEOHVE\WKH&LW\DWWKDWGDWH5HDOSURSHUW\WD[HVDUHSD\DEOH E\SURSHUW\RZQHUV RQ0D\DQG2FWREHURIHDFKFDOHQGDU\HDU3HUVRQDOSURSHUW\WD[HVDUHSD\DEOHE\WD[SD\HUVRQ)HEUXDU\DQG-XQHRIHDFK\HDU7KHVHWD[HVDUHFROOHFWHGE\WKH&RXQW\DQGUHPLWWHGWRWKH&LW\RQRUEHIRUH-XO\DQG'HFHPEHURIWKHVDPH\HDU'HOLQTXHQWFROOHFWLRQV IRU1RYHPEHUDQG'HFHPEHUDUHUHFHLYHGWKHIROORZLQJ-DQXDU\7KH&LW\KDVQRDELOLW\WRHQIRUFHSD\PHQWRISURSHUW\WD[HVE\SURSHUW\RZQHUV7KH&RXQW\SRVVHVVHVWKLVDXWKRULW\*RYHUQPHQW:LGH)LQDQFLDO6WDWHPHQWV7KH &LW\ UHFRJQL]HV SURSHUW\WD[ UHYHQXH LQ WKH SHULRG IRU ZKLFKWKHWD[HVZHUHOHYLHG8QFROOHFWLEOHSURSHUW\WD[HVDUHQRWPDWHULDODQGKDYHQRWEHHQUHSRUWHG*RYHUQPHQWDO)XQG)LQDQFLDO6WDWHPHQWV7KH&LW\UHFRJQL]HVSURSHUW\WD[UHYHQXHZKHQLWEHFRPHVERWKPHDVXUDEOHDQGDYDLODEOH WR ILQDQFH H[SHQGLWXUHV RI WKH FXUUHQW SHULRG ,Q SUDFWLFH FXUUHQW DQGGHOLQTXHQW WD[HV DQG VWDWH FUHGLWV UHFHLYHG E\ WKH &LW\ LQ -XO\ 'HFHPEHU DQG-DQXDU\ DUH UHFRJQL]HG DV UHYHQXH IRU WKH FXUUHQW \HDU 7D[HV FROOHFWHG E\ WKH&RXQW\E\'HFHPEHU UHPLWWHGWRWKH&LW\WKHIROORZLQJ-DQXDU\ DQGWD[HVDQGFUHGLWVQRWUHFHLYHGDWWKH\HDUHQGDUHFODVVLILHGDVGHOLQTXHQWDQGGXHIURP&RXQW\WD[HVUHFHLYDEOH7KHSRUWLRQRIGHOLQTXHQWWD[HVQRWFROOHFWHGE\WKH&LW\LQ-DQXDU\DUHIXOO\RIIVHWE\GHIHUUHGLQIORZVRIUHVRXUFHVEHFDXVHWKH\DUHQRWDYDLODEOHWRILQDQFHFXUUHQWH[SHQGLWXUHVA-25 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' ) 5HYHQXH5HFRJQLWLRQ &RQWLQXHG 6SHFLDO$VVHVVPHQW5HYHQXH5HFRJQLWLRQ6SHFLDODVVHVVPHQWVDUHOHYLHGDJDLQVWEHQHILWHGSURSHUWLHVIRUWKHFRVWRUDSRUWLRQRIWKHFRVWRIVSHFLDODVVHVVPHQWLPSURYHPHQWSURMHFWVLQDFFRUGDQFHZLWKVWDWHVWDWXWHV7KHVHDVVHVVPHQWVDUHFROOHFWLEOHE\WKH&LW\RYHUDWHUPRI\HDUVXVXDOO\FRQVLVWHQWZLWKWKHWHUPRIWKHUHODWHGERQGLVVXH&ROOHFWLRQRIDQQXDOLQVWDOOPHQWV LQFOXGLQJLQWHUHVW LVKDQGOHGE\WKH&RXQW\$XGLWRULQWKHVDPHPDQQHUDVSURSHUW\WD[HV 3URSHUW\ RZQHUV DUH DOORZHG WR DQG RIWHQ GR SUHSD\ IXWXUH LQVWDOOPHQWVZLWKRXWLQWHUHVWRUSUHSD\PHQWSHQDOWLHV2QFHDVSHFLDODVVHVVPHQWUROOLVDGRSWHGWKHDPRXQWDWWULEXWHGWRHDFKSDUFHOLVDOLHQXSRQWKDWSURSHUW\XQWLOIXOOSD\PHQWLVPDGHRUWKHDPRXQWLVGHWHUPLQHGWREHH[FHVVLYHE\WKH&LW\&RXQFLORUFRXUWDFWLRQ,IVSHFLDODVVHVVPHQWVDUHDOORZHGWRJRGHOLQTXHQWWKHSURSHUW\LVVXEMHFWWRWD[IRUIHLWVDOH3XUVXDQWWRVWDWHVWDWXWHVDSURSHUW\ VKDOO EH VXEMHFW WR D WD[ IRUIHLW VDOH DIWHU WKUHH \HDUVXQOHVVLWLVKRPHVWHDGHGDJULFXOWXUDORUVHDVRQDOUHFUHDWLRQDOODQGLQZKLFKHYHQWWKHSURSHUW\LVVXEMHFWWRVXFKVDOHDIWHUILYH\HDUV*RYHUQPHQW:LGH)LQDQFLDO6WDWHPHQWV7KH&LW\UHFRJQL]HVVSHFLDODVVHVVPHQWUHYHQXHLQWKHSHULRGWKDWWKHDVVHVVPHQWUROO ZDV DGRSWHG E\ WKH &LW\ &RXQFLO 8QFROOHFWLEOH VSHFLDO DVVHVVPHQWV DUH QRWPDWHULDODQGKDYHQRWEHHQUHSRUWHG*RYHUQPHQWDO)XQG)LQDQFLDO6WDWHPHQWV5HYHQXH IURP VSHFLDO DVVHVVPHQWV LV UHFRJQL]HG E\ WKH &LW\ ZKHQLWEHFRPHVPHDVXUDEOH DQG DYDLODEOH WR ILQDQFH H[SHQGLWXUHV RI WKH FXUUHQW ILVFDO SHULRG ,QSUDFWLFH FXUUHQW DQG GHOLQTXHQW VSHFLDO DVVHVVPHQWV UHFHLYHG E\ WKH &LW\ DUHUHFRJQL]HGDVUHYHQXHIRUWKHFXUUHQW\HDU6SHFLDODVVHVVPHQWVWKDWDUHFROOHFWHGE\WKH&RXQW\E\'HFHPEHU UHPLWWHGWRWKH&LW\WKHIROORZLQJ-DQXDU\ DUHDOVRUHFRJQL]HGDVUHYHQXHIRUWKHFXUUHQW\HDU$OOUHPDLQLQJGHOLQTXHQWGHIHUUHGDQGVSHFLDO GHIHUUHG DVVHVVPHQWV UHFHLYDEOH LQ JRYHUQPHQWDO IXQGV DUH FRPSOHWHO\RIIVHW E\ GHIHUUHG LQIORZV RI UHVRXUFHV 7KH IROORZLQJ LV D EUHDNGRZQ RI VSHFLDODVVHVVPHQWVUHFHLYDEOHDW'HFHPEHU (QWHUSULVH)XQGV'HEW6HUYLFH &RQVWUXFWLRQ 8WLOLWLHV6SHFLDO$VVHVVPHQWV5HFHLYDEOH 'HOLQTXHQW 'HIHUUHG 7RWDO *RYHUQPHQWDO)XQGV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' * ,QYHQWRULHVDQG3UHSDLG,WHPV,QYHQWRULHVRIWKHSURSULHWDU\IXQGVDUHVWDWHGDWFRVWDQGDUHUHFRUGHGDVH[SHQVHVZKHQ FRQVXPHG UDWKHU WKDQ ZKHQ SXUFKDVHG $OO LQYHQWRULHV XVH WKH ILUVWLQILUVWRXW ),)2 PHWKRG&HUWDLQSD\PHQWVWRYHQGRUVUHIOHFWFRVWVDSSOLFDEOHWRIXWXUHDFFRXQWLQJSHULRGVDQGDUHUHFRUGHGDVSUHSDLGLWHPVLQERWKJRYHUQPHQWZLGHDQGIXQGILQDQFLDOVWDWHPHQWVDQGDUHUHFRUGHGDVH[SHQGLWXUHVRUH[SHQVHVZKHQFRQVXPHG+ &DSLWDO$VVHWV&DSLWDO DVVHWV ZKLFK LQFOXGH SURSHUW\ EXLOGLQJV LPSURYHPHQWV HTXLSPHQW SDUNVLQIUDVWUXFWXUHDVVHWV URDGVEULGJHVVLGHZDONVDQGVLPLODULWHPV DQGLQWDQJLEOHDVVHWVVXFK DV HDVHPHQWV DUH UHSRUWHG LQ WKH DSSOLFDEOH JRYHUQPHQWDO RU EXVLQHVVW\SHDFWLYLWLHVFROXPQVLQWKHJRYHUQPHQWZLGHILQDQFLDOVWDWHPHQWV&DSLWDODVVHWVDUHDOVRUHSRUWHGLQWKHSURSULHWDU\IXQGILQDQFLDOVWDWHPHQWVEXWQRWLQWKHJRYHUQPHQWDOIXQGILQDQFLDOVWDWHPHQWV&DSLWDODVVHWVDUHGHILQHGE\WKHJRYHUQPHQWDVDVVHWVZLWKDQLQLWLDOLQGLYLGXDOFRVWRIPRUHWKDQ DPRXQWQRWURXQGHG DQGDQHVWLPDWHGXVHIXOOLIHLQH[FHVVRIWKUHH\HDUV 6XFK DVVHWV DUH UHFRUGHG DW KLVWRULFDO FRVW RU HVWLPDWHG KLVWRULFDO FRVW LISXUFKDVHGRUFRQVWUXFWHG'RQDWHGFDSLWDODVVHWVDUHUHFRUGHGDWHVWLPDWHGDFTXLVLWLRQYDOXHDWWKHGDWHRIGRQDWLRQ7KHFRVWVRIQRUPDOPDLQWHQDQFHDQGUHSDLUVWKDWGRQRWDGGWRWKHYDOXHRIWKHDVVHWRUPDWHULDOO\H[WHQGDVVHWVOLYHVDUHQRWFDSLWDOL]HG,QIUDVWUXFWXUHDVVHWVLQFOXGHDOORIWKH&LW\¶VDVVHWVVLQFHLQFHSWLRQ3URSHUW\SODQWDQGHTXLSPHQWRIWKHSULPDU\JRYHUQPHQWDUHGHSUHFLDWHGXVLQJWKHVWUDLJKWOLQHPHWKRGRYHUWKHIROORZLQJHVWLPDWHGXVHIXOOLYHV $VVHWV/LIH*ROI&RXUVHWR<HDUV/DQG,PSURYHPHQWVWR<HDUV%XLOGLQJDQG6WUXFWXUHVWR<HDUV)XUQLWXUHDQG2IILFH(TXLSPHQWWR<HDUV9HKLFOHVDQG(TXLSPHQWWR<HDUV3DUNVWR<HDUV8WLOLW\,QIUDVWUXFWXUHWR<HDUV&DSLWDODVVHWVWKDWDUHQRWGHSUHFLDWHG LQFOXGHODQG HDVHPHQWVDQGFRQVWUXFWLRQLQSURJUHVVA-26 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' , &RPSHQVDWHG$EVHQFHV,WLVWKH&LW\¶VSROLF\WRSHUPLWHPSOR\HHVWRDFFXPXODWHHDUQHGEXWXQXVHGYDFDWLRQDQGVLFNSD\EHQHILWV$OOYDFDWLRQSD\LVDFFUXHGZKHQLQFXUUHGLQWKHJRYHUQPHQWZLGHDQGSURSULHWDU\ IXQG ILQDQFLDO VWDWHPHQWV $ OLDELOLW\ IRU WKHVH DPRXQWV LV UHSRUWHG LQJRYHUQPHQWDOIXQGVRQO\LIWKH\KDYHPDWXUHGIRUH[DPSOHDVDUHVXOWRIHPSOR\HHUHVLJQDWLRQVDQGUHWLUHPHQWV,QDFFRUGDQFHZLWKWKHSURYLVLRQVRIDFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFDQROLDELOLW\LVUHFRUGHGIRUQRQYHVWLQJDFFXPXODWLQJULJKWVWRUHFHLYHVLFNSD\EHQHILWV+RZHYHUDOLDELOLW\LVUHFRJQL]HGLQWKHJRYHUQPHQWZLGH DQG SURSULHWDU\ IXQG ILQDQFLDO VWDWHPHQWV IRU WKDW SRUWLRQ RIDFFXPXODWLQJ VLFN OHDYH EHQHILWVWKDW LV YHVWHG DV VHYHUDQFH SD\ $FFRUGLQJ WR &LW\SROLF\YHVWHGVLFNOHDYHEHQHILWVDUHOLTXLGDWHGLQWRDKHDOWKFDUHVDYLQJVSODQXSRQVHSDUDWLRQ- 6WDWH:LGH3HQVLRQ3ODQV)RU SXUSRVHV RI PHDVXULQJ WKH QHW SHQVLRQ OLDELOLW\ GHIHUUHG RXWIORZVLQIORZV RIUHVRXUFHV DQG SHQVLRQ H[SHQVH LQIRUPDWLRQ DERXW WKH ILGXFLDU\QHWSRVLWLRQRIWKH3XEOLF(PSOR\HHV5HWLUHPHQW$VVRFLDWLRQ 3(5$ DQGDGGLWLRQVWRGHGXFWLRQVIURPWKH3(5$¶V ILGXFLDU\ QHW SRVLWLRQ KDYHEHHQ GHWHUPLQHGRQWKHVDPHEDVLVDVWKH\ DUHUHSRUWHG E\ WKH 3(5$ H[FHSW WKDW WKH 3(5$¶V ILVFDO \HDUHQG LV-XQH )RU WKLVSXUSRVHSODQFRQWULEXWLRQVDUHUHFRJQL]HGDVRIHPSOR\HUSD\UROOSDLGGDWHVDQGEHQHILWSD\PHQWVDQGUHIXQGVDUHUHFRJQL]HGZKHQGXHDQGSD\DEOHLQDFFRUGDQFHZLWKWKHEHQHILWWHUPV,QYHVWPHQWVDUHUHSRUWHGDWIDLUYDOXH3HQVLRQ OLDELOLWLHV DUH OLTXLGDWHG E\ YDULRXV JRYHUQPHQWDO IXQGV EDVHG RQ ZKHUH WKHFRUUHVSRQGLQJHPSOR\HHV¶VDODULHVDUHDOORFDWHG. /RQJ7HUP2EOLJDWLRQV,Q WKH JRYHUQPHQWZLGH ILQDQFLDO VWDWHPHQWV DQG SURSULHWDU\ IXQG W\SHV LQ WKH IXQGILQDQFLDO VWDWHPHQWV ORQJWHUPGHEW DQG RWKHU ORQJWHUP REOLJDWLRQV DUH UHSRUWHG DVOLDELOLWLHVLQWKHDSSOLFDEOHJRYHUQPHQWDODFWLYLWLHVEXVLQHVVW\SHDFWLYLWLHVRUSURSULHWDU\IXQGW\SHVWDWHPHQWRIQHWSRVLWLRQ%RQGSUHPLXPV DQGGLVFRXQWVDUH GHIHUUHGDQGDPRUWL]HGRYHUWKHOLIHRIWKHERQGXVLQJWKHHIIHFWLYHLQWHUHVWPHWKRG%RQGVSD\DEOHDUHUHSRUWHGQHWRIWKHDSSOLFDEOHERQGSUHPLXPRUGLVFRXQW,QWKHIXQGILQDQFLDOVWDWHPHQWVJRYHUQPHQWDOIXQGW\SHVUHFRJQL]HERQGSUHPLXPVDQGGLVFRXQWVDVZHOODVERQGLVVXDQFHFRVWVGXULQJWKHFXUUHQWSHULRG7KHIDFHDPRXQWRIGHEWLVVXHGSOXVDQ\SUHPLXPUHFHLYHGLVUHSRUWHGDVRWKHUILQDQFLQJVRXUFHV'LVFRXQWVRQGHEWLVVXDQFHVDUHUHSRUWHGDVRWKHUILQDQFLQJXVHV,VVXDQFHFRVWVZKHWKHURUQRWZLWKKHOG IURP WKH DFWXDO GHEW SURFHHGV UHFHLYHG DUH UHSRUWHG DV GHEW VHUYLFHH[SHQGLWXUHV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' / 'HIHUUHG2XWIORZV,QIORZVRI5HVRXUFHV,QDGGLWLRQWRDVVHWVWKHVWDWHPHQWRIILQDQFLDOSRVLWLRQZLOOVRPHWLPHVUHSRUWDVHSDUDWHVHFWLRQIRUGHIHUUHGRXWIORZVRIUHVRXUFHV7KLVVHSDUDWHILQDQFLDOVWDWHPHQWHOHPHQWGHIHUUHGRXWIORZVRIUHVRXUFHVUHSUHVHQWVDFRQVXPSWLRQRIQHWDVVHWVWKDWDSSOLHVWRDIXWXUH SHULRG V DQG VR ZLOO QRW EH UHFRJQL]HG DV DQ RXWIORZ RI UHVRXUFHV H[SHQVHH[SHQGLWXUH XQWLOWKHQ7KH&LW\KDVWZRLWHPVZKLFKTXDOLILHVIRUUHSRUWLQJLQWKLVFDWHJRU\'HIHUUHG RXWIORZV RI UHVRXUFHV UHODWHG WR SHQVLRQV DQG 23(% DUH UHSRUWHG LQ WKHJRYHUQPHQWZLGH DQG HQWHUSULVH IXQGV VWDWHPHQW RI QHW SRVLWLRQ7KHVHGHIHUUHGRXWIORZVUHVXOWIURPGLIIHUHQFHVEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFHFKDQJHVRIDVVXPSWLRQVGLIIHUHQFHVEHWZHHQSURMHFWHGDQGDFWXDOLQYHVWPHQWHDUQLQJVFKDQJHVLQSURSRUWLRQ DQG FRQWULEXWLRQV WR WKH SODQ VXEVHTXHQW WR WKH PHDVXUHPHQW GDWH DQGEHIRUHWKHHQGRIWKHUHSRUWLQJSHULRG7KHVHDPRXQWVDUHGHIHUUHGDQGDPRUWL]HGDVUHTXLUHGXQGHUSHQVLRQDQG23(%VWDQGDUGV,QDGGLWLRQWROLDELOLWLHVVWDWHPHQWVRIILQDQFLDOSRVLWLRQRUEDODQFHVKHHWVZLOOVRPHWLPHVUHSRUW D VHSDUDWH VHFWLRQ IRU GHIHUUHG LQIORZV RI UHVRXUFHV 7KLV VHSDUDWH ILQDQFLDOVWDWHPHQWHOHPHQWUHSUHVHQWVDQDFTXLVLWLRQRIQHWDVVHWVWKDWDSSOLHVWRIXWXUHSHULRGVDQGVRZLOOQRWEHUHFRJQL]HGDVDQLQIORZRIUHVRXUFHV UHYHQXH XQWLOWKDWWLPH7KH&LW\KDVWKUHHLWHPVZKLFKTXDOLI\IRUUHSRUWLQJLQWKLVFDWHJRU\8QDYDLODEOH UHYHQXH LV UHSRUWHG RQO\ LQ WKH JRYHUQPHQWDO IXQGVEDODQFH VKHHW 7KHJRYHUQPHQWDOIXQGVUHSRUWXQDYDLODEOHUHYHQXHIURPWZRVRXUFHV SURSHUW\WD[HVDQGVSHFLDO DVVHVVPHQWV 7KHVH DPRXQWV DUH GHIHUUHG DQG UHFRJQL]HGDVDQLQIORZRIUHVRXUFHVLQWKHSHULRGWKHDPRXQWVEHFRPHDYDLODEOH'HIHUUHG LQIORZV RI UHVRXUFHV UHODWHG WR SHQVLRQV DQG 23(% DUHUHSRUWHG LQ WKHJRYHUQPHQWZLGHDQGHQWHUSULVHIXQGVWDWHPHQWRIQHWSRVLWLRQ7KHVHGHIHUUHGLQIORZVUHVXOW IURP GLIIHUHQFHV EHWZHHQ H[SHFWHG DQG DFWXDO H[SHULHQFH FKDQJHV RIDVVXPSWLRQV DQG WKH GLIIHUHQFHEHWZHHQ SURMHFWHG DQG DFWXDO LQYHVWPHQW HDUQLQJV7KHVH DPRXQWV DUH GHIHUUHG DQG DPRUWL]HG DV UHTXLUHG XQGHU SHQVLRQ DQG 23(%VWDQGDUGV0 ,QWHUIXQG7UDQVDFWLRQV,QWHUIXQGVHUYLFHVSURYLGHGDQGXVHGDUHDFFRXQWHGIRUDVUHYHQXHVH[SHQGLWXUHVRUH[SHQVHV 7UDQVDFWLRQV WKDW FRQVWLWXWH UHLPEXUVHPHQWV WR D IXQG IRU H[SHQGLWXUHVH[SHQVHVLQLWLDOO\PDGHIURPLWWKDWDUHSURSHUO\DSSOLFDEOHWRDQRWKHUIXQGDUHUHFRUGHGDV H[SHQGLWXUHVH[SHQVHV LQ WKH UHLPEXUVLQJ IXQG DQG DV UHGXFWLRQV RIH[SHQGLWXUHVH[SHQVHVLQWKHIXQGWKDWLVUHLPEXUVHG,QWHUIXQGORDQVDUHUHSRUWHGDVDQLQWHUIXQGORDQUHFHLYDEOHRUSD\DEOHZKLFKRIIVHWVWKHPRYHPHQWRIFDVKEHWZHHQIXQGV$OORWKHULQWHUIXQGWUDQVDFWLRQVDUHUHSRUWHGDVWUDQVIHUVDQGDUHHOLPLQDWHGWRWKHH[WHQWSRVVLEOHRQWKHJRYHUQPHQWZLGHVWDWHPHQWVA-27 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' 1 )XQG%DODQFH&ODVVLILFDWLRQ,Q WKH IXQG ILQDQFLDO VWDWHPHQWV JRYHUQPHQWDO IXQGV UHSRUW IXQG EDODQFH LQFODVVLILFDWLRQVWKDWGLVFORVHFRQVWUDLQWVIRUZKLFKDPRXQWVLQWKRVHIXQGVFDQEHVSHQW7KHVHFODVVLILFDWLRQVDUHDVIROORZV x1RQVSHQGDEOH±&RQVLVWVRIDPRXQWVWKDWDUHQRWLQVSHQGDEOHIRUPVXFKDVSUHSDLGLWHPVLQYHQWRU\DQGRWKHUORQJWHUPDVVHWVx5HVWULFWHG± &RQVLVWV RI DPRXQWV UHODWHG WR H[WHUQDOO\ LPSRVHG FRQVWUDLQWVHVWDEOLVKHG E\ FUHGLWRUV JUDQWRUV RU FRQWULEXWRUV RU FRQVWUDLQWV LPSRVHG E\VWDWHVWDWXWRU\SURYLVLRQVx&RPPLWWHG±&RQVLVWVRILQWHUQDOO\LPSRVHGFRQVWUDLQWVWKDWDUHHVWDEOLVKHGE\UHVROXWLRQRIWKH&LW\&RXQFLO7KRVHFRPPLWWHGDPRXQWVFDQQRWEHXVHGIRUDQ\RWKHUSXUSRVHXQOHVVWKH&LW\&RXQFLOUHPRYHVRUFKDQJHVWKHVSHFLILHGXVHE\WDNLQJWKHVDPHW\SHRIDFWLRQLWHPSOR\HGWRSUHYLRXVO\FRPPLWWKRVHDPRXQWVx$VVLJQHG±&RQVLVWVRILQWHUQDOO\LPSRVHGFRQVWUDLQWV7KHVHFRQVWUDLQWVFRQVLVWRIDPRXQWVLQWHQGHGWREHXVHGE\WKH&LW\IRUVSHFLILFSXUSRVHVEXWGRQRWPHHWWKH FULWHULD WR EH FODVVLILHG DV UHVWULFWHG RU FRPPLWWHG ,Q WKH JHQHUDO IXQGDVVLJQHGDPRXQWVUHSUHVHQWLQWHQGHGXVHVHVWDEOLVKHGE\WKH&LW\&RXQFLO,QWKH IXQG EDODQFH SROLF\ DXWKRULW\ WR DVVLJQ DPRXQWV IRU VSHFLILF SXUSRVHV LVOLPLWHGWRWKH&LW\&RXQFLOx8QDVVLJQHG±7KHUHVLGXDOFODVVLILFDWLRQIRUWKHJHQHUDOIXQGZKLFKDOVRUHIOHFWVQHJDWLYHUHVLGXDODPRXQWVLQRWKHUIXQGV:KHQERWKUHVWULFWHGDQGXQUHVWULFWHGUHVRXUFHVDUHDYDLODEOHIRUXVHLWLVWKH&LW\¶VSROLF\WRILUVWXVHUHVWULFWHGUHVRXUFHVDQGWKHQXVHXQUHVWULFWHGUHVRXUFHVDVWKH\DUHQHHGHG:KHQ FRPPLWWHG DVVLJQHG RU XQDVVLJQHG UHVRXUFHV DUH DYDLODEOHIRUXVHLWLVWKH&LW\¶V SROLF\ WR XVH UHVRXUFHV LQ WKH IROORZLQJ RUGHU FRPPLWWHG DVVLJQHG DQG XQDVVLJQHG2 1HW3RVLWLRQ,Q WKH JRYHUQPHQWZLGH DQG SURSULHWDU\ IXQG ILQDQFLDO VWDWHPHQWVQHWSRVLWLRQUHSUHVHQWVWKHGLIIHUHQFHEHWZHHQDVVHWVGHIHUUHGRXWIORZVRIUHVRXUFHVOLDELOLWLHVDQGGHIHUUHGLQIORZVRIUHVRXUFHV1HWSRVLWLRQLVGLVSOD\HGLQWKUHHFRPSRQHQWV x1HW ,QYHVWPHQW LQ &DSLWDO $VVHWV± &RQVLVWV RI FDSLWDO DVVHWV QHW RIDFFXPXODWHGGHSUHFLDWLRQUHGXFHGE\WKHRXWVWDQGLQJEDODQFHRIDQ\ORQJWHUPGHEWXVHGWREXLOGRUDFTXLUHWKHFDSLWDODVVHWVx5HVWULFWHG1HW 3RVLWLRQ± &RQVLVWV RI QHW SRVLWLRQ UHVWULFWHG ZKHQWKHUH DUHOLPLWDWLRQV LPSRVHG RQ WKHLU XVH WKURXJK H[WHUQDO UHVWULFWLRQVLPSRVHG E\FUHGLWRUVJUDQWRUVRUODZVRUUHJXODWLRQVRIRWKHUJRYHUQPHQWV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 6800$5<2)6,*1,),&$17$&&2817,1*32/,&,(6 &217,18(' 2 1HW3RVLWLRQ &RQWLQXHG x8QUHVWULFWHG1HW3RVLWLRQ±$OORWKHUQHWSRVLWLRQWKDWGRQRWPHHWWKHGHILQLWLRQRI³UHVWULFWHG´RU³QHWLQYHVWPHQWLQFDSLWDODVVHWV´:KHQERWKUHVWULFWHGDQGXQUHVWULFWHGUHVRXUFHVDUHDYDLODEOHIRUXVHLWLVWKH&LW\¶VSROLF\WRILUVWXVHUHVWULFWHGUHVRXUFHVDQGWKHQXVHXQUHVWULFWHGUHVRXUFHVDVWKH\DUHQHHGHG3 8VHRI(VWLPDWHV7KH SUHSDUDWLRQ RI ILQDQFLDO VWDWHPHQWV LQ DFFRUGDQFH ZLWK DFFRXQWLQJ SULQFLSOHVJHQHUDOO\ DFFHSWHG LQ WKH 8QLWHG 6WDWHV RI $PHULFD UHTXLUHV PDQDJHPHQW WR PDNHHVWLPDWHVWKDWDIIHFWDPRXQWVUHSRUWHGLQWKHILQDQFLDOVWDWHPHQWVGXULQJWKHUHSRUWLQJSHULRG$FWXDOUHVXOWVFRXOGGLIIHUIURPVXFKHVWLPDWHV127( &$6+$1',19(670(176$ &RPSRQHQWVRI&DVKDQG,QYHVWPHQWV&DVKDQGLQYHVWPHQWVDW\HDUHQGFRQVLVWRIWKHIROORZLQJ 'HSRVLWV &DVKRQKDQG,QYHVWPHQWV7RWDO&DVKDQGLQYHVWPHQWVDUHSUHVHQWHGLQWKHILQDQFLDOVWDWHPHQWVDVIROORZV &DVKDQG,QYHVWPHQWV6WDWHPHQWRI1HW3RVLWLRQ 5HVWULFWHG&DVKDQG,QYHVWPHQWV6WDWHPHQWRI1HW3RVLWLRQ&DVKDQG,QYHVWPHQWV6WDWHPHQWRI)LGXFLDU\1HW3RVLWLRQ 7RWDO7KH &LW\ KDG UHVWULFWHG LQYHVWPHQWV RI DV RI 'HFHPEHU WKDWUHSUHVHQWVXQVSHQWERQGSURFHHGVWREHXVHGIRUERQGUHIXQGLQJSD\PHQWVLQ% 'HSRVLWV,Q DFFRUGDQFH ZLWK DSSOLFDEOH 0LQQHVRWD 6WDWXWHV WKH &LW\ PDLQWDLQV GHSRVLWV DWGHSRVLWRU\EDQNVDXWKRUL]HGE\WKH&LW\&RXQFLOLQFOXGLQJFKHFNLQJDFFRXQWVVDYLQJVDFFRXQWVDQGFHUWLILFDWHVRIGHSRVLWA-28 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &$6+$1',19(670(17632/,&,(6 &217,18(' % 'HSRVLWV &RQWLQXHG 7KHIROORZLQJLVFRQVLGHUHGWKHPRVWVLJQLILFDQWULVNDVVRFLDWHGZLWKGHSRVLWV &XVWRGLDO&UHGLW5LVN±,QWKHFDVHRIGHSRVLWVWKLVLVWKHULVNWKDWLQWKHHYHQWRIDEDQNIDLOXUHWKH&LW\¶VGHSRVLWVPD\EHORVW0LQQHVRWD 6WDWXWHV UHTXLUH WKDW DOO GHSRVLWV EH SURWHFWHG E\ IHGHUDO GHSRVLWLQVXUDQFH FRUSRUDWH VXUHW\ ERQG RU FROODWHUDO 7KH PDUNHW YDOXH RI FROODWHUDOSOHGJHGPXVWHTXDORIWKHGHSRVLWVQRWFRYHUHGE\IHGHUDOGHSRVLWLQVXUDQFHRUFRUSRUDWHVXUHW\ERQGV$XWKRUL]HGFROODWHUDOLQFOXGHVWUHDVXU\ELOOVQRWHVDQGERQGV LVVXHVRI86JRYHUQPHQWDJHQFLHV JHQHUDOREOLJDWLRQVUDWHG³$´RUEHWWHU UHYHQXHREOLJDWLRQVUDWHG³$$´RUEHWWHU LUUHYRFDEOHVWDQGDUGOHWWHUVRIFUHGLWLVVXHGE\ WKH )HGHUDO +RPH /RDQ %DQN DQG FHUWLILFDWHV RI GHSRVLW 0LQQHVRWD 6WDWXWHVUHTXLUHWKDWVHFXULWLHVSOHGJHGDVFROODWHUDOEHKHOGLQVDIHNHHSLQJLQDUHVWULFWHGDFFRXQWDWWKH)HGHUDO5HVHUYH%DQNRULQDQDFFRXQWDWDWUXVWGHSDUWPHQWRIDFRPPHUFLDOEDQNRURWKHUILQDQFLDOLQVWLWXWLRQWKDWLVQRWRZQHGRUFRQWUROOHGE\WKHILQDQFLDOLQVWLWXWLRQIXUQLVKLQJWKHFROODWHUDO7KH&LW\¶VLQYHVWPHQWSROLF\GRHVQRWFRQWDLQIXUWKHUUHVWULFWLRQVRQWKHW\SHVRIFROODWHUDOUHTXLUHG$W\HDUHQGWKHFDUU\LQJDPRXQWRIWKH&LW\¶VGHSRVLWVZDV ZKLOHWKHEDODQFHRQWKHEDQNUHFRUGVZDV$W'HFHPEHUDOORIWKH&LW\¶VGHSRVLWVZHUHSURSHUO\FROODWHUDOL]HGLQDFFRUGDQFHZLWKVWDWHVWDWXWHV& ,QYHVWPHQWV7KH&LW\KDVWKHIROORZLQJLQYHVWPHQWVDW\HDUHQG )DLU9DOXH0HDVXUHPHQWV,QYHVWPHQW 5DWLQJ $JHQF\ 8VLQJ WR WR!7RWDO867UHDVXULHV1$ 1$ /HYHO 1HJRWLDEOH&'V15 15 /HYHO 6%$1RWHV$$ 6 3 /HYHO )+/%$$ 6 3 /HYHO )+/0&$$ 6 3 /HYHO )10$$$ 6 3 /HYHO ))&%$$ 6 3 /HYHO 0XQLFLSDO%RQGV $$WR$$$ 6 3 /HYHO &RUSRUDWH%RQGV$$ 6 3 /HYHO 6XEWRWDO 0RQH\0DUNHW 0)XQG 7RWDOLQYHVWPHQWV1$1RW$SSOLFDEOH151RW5DWHG 7KH&LW\ VPRQH\PDUNHWLQYHVWPHQWVGRQRWKDYHPDWXULWLHV,QWHUHVW5LVN&UHGLW5LVN0DWXULW\'XUDWLRQLQ<HDUV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &$6+$1',19(670(17632/,&,(6 &217,18(' & ,QYHVWPHQWV &RQWLQXHG 7KH 0LQQHVRWD 0XQLFLSDO 0RQH\ 0DUNHW )XQG 0 )XQG LV UHJXODWHG E\ 0LQQHVRWD6WDWXWHVDQGWKHERDUGRIGLUHFWRUVRIWKH/HDJXHRI0LQQHVRWD&LWLHV7KH0)XQGLVDQH[WHUQDOLQYHVWPHQWSRROQRWUHJLVWHUHGZLWKWKH6HFXULWLHV([FKDQJH&RPPLVVLRQ 6(& WKDWIROORZVWKHVDPHUHJXODWRU\UXOHVRIWKH6(&7KH&LW\¶VLQYHVWPHQWLQWKH0)XQGLVPHDVXUHGDWDPRUWL]HGFRVWZKLFKDSSUR[LPDWHVIDLUYDOXH7KHIDLUYDOXHRILWVSRVLWLRQLQWKHSRROLVWKHVDPHDVWKHYDOXHRIWKHSRROVKDUHV7KHIXQGGRHVQRWKDYHDQ\OLPLWDWLRQVRUUHVWULFWLRQVRQSDUWLFLSDQWZLWKGUDZDOV,QYHVWPHQWVDUHVXEMHFWWRYDULRXVULVNVWKHIROORZLQJRIZKLFKDUHFRQVLGHUHGWKHPRVWVLJQLILFDQW &XVWRGLDO&UHGLW5LVN±)RULQYHVWPHQWVWKLVLVWKHULVNWKDWLQWKHHYHQWRIDIDLOXUHRIWKHFRXQWHUSDUW\WRDQLQYHVWPHQWWUDQVDFWLRQ W\SLFDOO\DEURNHUGHDOHU WKH&LW\ZRXOGQRWEHDEOHWRUHFRYHUWKHYDOXHRILWVLQYHVWPHQWVRUFROODWHUDOVHFXULWLHVWKDWDUHLQWKHSRVVHVVLRQRIDQRXWVLGHSDUW\7KH&LW\¶VLQYHVWPHQWSROLF\VSHFLILFDOO\DGGUHVVHVFXVWRGLDOFUHGLWULVNUHTXLULQJWKH&LW\WROLPLWLWVH[SRVXUHE\SXUFKDVLQJLQVXUHGRUUHJLVWHUHGLQYHVWPHQWVRUE\WKHFRQWURORIZKRKROGVWKHVHFXULWLHV&UHGLW5LVN±7KLVLVWKHULVNWKDWDQLVVXHURURWKHUFRXQWHUSDUW\WRDQLQYHVWPHQWZLOOQRW IXOILOO LWV REOLJDWLRQV 0LQQHVRWD 6WDWXWHV OLPLW WKH &LW\¶V LQYHVWPHQWV WR GLUHFWREOLJDWLRQVRUREOLJDWLRQVJXDUDQWHHGE\WKH8QLWHG6WDWHVRULWVDJHQFLHV VKDUHVRILQYHVWPHQWFRPSDQLHVUHJLVWHUHGXQGHUWKH)HGHUDO,QYHVWPHQW&RPSDQ\$FWRI WKDW UHFHLYH WKH KLJKHVW FUHGLW UDWLQJ DUH UDWHG LQ RQH RI WKH WZR KLJKHVW UDWLQJFDWHJRULHV E\ D VWDWLVWLFDO UDWLQJ DJHQF\ DQG DOO RI WKH LQYHVWPHQWV KDYH D ILQDOPDWXULW\RIWKLUWHHQPRQWKVRUOHVV JHQHUDOREOLJDWLRQVUDWHG³$$´RUEHWWHU JHQHUDOREOLJDWLRQVRIWKH0LQQHVRWD+RXVLQJ)LQDQFH$JHQF\UDWHG³$´RUEHWWHU EDQNHUV¶DFFHSWDQFHV RI 8QLWHG 6WDWHV EDQNV HOLJLEOH IRU SXUFKDVH E\ WKH )HGHUDO 5HVHUYH6\VWHP FRPPHUFLDO SDSHU LVVXHG E\ 8QLWHG 6WDWHV FRUSRUDWLRQV RU WKHLU &DQDGLDQVXEVLGLDULHVUDWHGRIWKHKLJKHVWTXDOLW\FDWHJRU\E\DWOHDVWWZRQDWLRQDOO\UHFRJQL]HGUDWLQJDJHQFLHVDQGPDWXULQJLQGD\VRUOHVV *XDUDQWHHG,QYHVWPHQW&RQWUDFWVJXDUDQWHHGE\D8QLWHG6WDWHVFRPPHUFLDOEDQNGRPHVWLFEUDQFKRIDIRUHLJQEDQNRUD8QLWHG6WDWHVLQVXUDQFHFRPSDQ\DQGZLWKDFUHGLWTXDOLW\LQRQHRIWKHWRSWZRKLJKHVW FDWHJRULHV UHSXUFKDVH RU UHYHUVH UHSXUFKDVH DJUHHPHQWV DQG VHFXULWLHVOHQGLQJ DJUHHPHQWV ZLWK ILQDQFLDO LQVWLWXWLRQV TXDOLILHG DV D ³GHSRVLWRU\´ E\ WKHJRYHUQPHQWHQWLW\ZLWKEDQNVWKDWDUHPHPEHUVRIWKH)HGHUDO5HVHUYH6\VWHPZLWKFDSLWDOL]DWLRQ H[FHHGLQJ WKDW DUH D SULPDU\ UHSRUWLQJ GHDOHU LQ 86JRYHUQPHQWVHFXULWLHVWRWKH)HGHUDO5HVHUYH%DQNRI1HZ<RUNRUFHUWDLQ0LQQHVRWDVHFXULWLHVEURNHUGHDOHUV7KH&LW\¶VLQYHVWPHQWSROLFLHVVSHFLILFDOO\DGGUHVVFUHGLWULVNIXUWKHUOLPLWLQJWKH&LW\¶VH[SRVXUHWRFUHGLWULVNE\UHTXLULQJWKDWDOOVWDWHDQGORFDOJRYHUQPHQWREOLJDWLRQVWREHUDWHG³$$´RUEHWWHUE\DQDWLRQDOUDWLQJDJHQF\&RQFHQWUDWLRQ5LVN±7KLVLVWKHULVNDVVRFLDWHGZLWKLQYHVWLQJDVLJQLILFDQWSRUWLRQRIWKH&LW\¶VLQYHVWPHQW FRQVLGHUHGRUPRUH LQWKHVHFXULWLHVRIDVLQJOHLVVXHUH[FOXGLQJ86JXDUDQWHHGLQYHVWPHQWV VXFKDV7UHDVXULHV LQYHVWPHQWSRROVDQGPXWXDOIXQGV7KH&LW\¶VLQYHVWPHQWSROLFLHVVSHFLILFDOO\DGGUHVVWKH&LW\¶VGHVLUHWROLPLWFRQFHQWUDWLRQULVNEXWGRQRWVHWVSHFLILFJXLGHOLQHVIRUPHDVXUHPHQWRIWKLVULVN$W\HDUHQGWKH&LW\¶VLQYHVWPHQWVLQFOXGHLQVHFXULWLHVLVVXHGE\)10$A-29 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &$6+$1',19(670(17632/,&,(6 &217,18(' & ,QYHVWPHQWV &RQWLQXHG ,QWHUHVW5DWH5LVN±7KLVLVWKHULVNRISRWHQWLDOYDULDELOLW\LQWKHIDLUYDOXHRIIL[HGUDWHLQYHVWPHQWUHVXOWLQJLQFKDQJHVLQLQWHUHVWUDWHV WKHORQJHUWKHSHULRGIRUZKLFKDQ LQWHUHVW UDWH LV IL[HG WKH JUHDWHU WKH ULVN 7KH &LW\¶V LQYHVWPHQW SROLFLHVVSHFLILFDOO\DGGUHVVWKH&LW\¶VGHVLUHWROLPLWLQWHUHVWUDWHULVNEXWGRQRWVHWVSHFLILFJXLGHOLQHVIRUPHDVXUHPHQWRIWKLVULVN127( &$3,7$/$66(76&DSLWDODVVHWDFWLYLW\IRUWKH\HDUHQGHG'HFHPEHULVDVIROORZV %HJLQQLQJ(QGLQJ%DODQFH ,QFUHDVHV 'HFUHDVHV %DODQFH*RYHUQPHQWDO$FWLYLWLHV &DSLWDO$VVHWV1RW%HLQJ'HSUHFLDWHG /DQG (DVHPHQWV &RQVWUXFWLRQLQ3URJUHVV 7RWDO&DSLWDO$VVHWV1RW%HLQJ'HSUHFLDWHG &DSLWDO$VVHWV%HLQJ'HSUHFLDWHG /DQG,PSURYHPHQWV %XLOGLQJVDQG6WUXFWXUHV)XUQLWXUHDQG2IILFH(TXLSPHQW 9HKLFOHVDQG(TXLSPHQW ,QIUDVWUXFWXUH3DUNV 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG /HVV$FFXPXODWHG'HSUHFLDWLRQIRU /DQG,PSURYHPHQWV %XLOGLQJVDQG6WUXFWXUHV )XUQLWXUHDQG2IILFH(TXLSPHQW 9HKLFOHVDQG(TXLSPHQW ,QIUDVWUXFWXUH 3DUNV 7RWDO$FFXPXODWHG'HSUHFLDWLRQ 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG1HW *RYHUQPHQWDO$FWLYLWLHV&DSLWDO$VVHWV1HW &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &$3,7$/$66(76 &217,18(' %HJLQQLQJ(QGLQJ%DODQFH ,QFUHDVHV 'HFUHDVHV %DODQFH%XVLQHVV7\SH$FWLYLWLHV &DSLWDO$VVHWV1RW%HLQJ'HSUHFLDWHG /DQG (DVHPHQWV &RQVWUXFWLRQLQ3URJUHVV 7RWDO&DSLWDO$VVHWV1RW%HLQJ'HSUHFLDWHG &DSLWDO$VVHWV%HLQJ'HSUHFLDWHG /DQG,PSURYHPHQWVDQG*ROI&RXUVH %XLOGLQJVDQG6WUXFWXUHV )XUQLWXUHDQG2IILFH(TXLSPHQW 9HKLFOHVDQG(TXLSPHQW 8WLOLW\,QIUDVWUXFWXUH /HDVH3URSHUW\&DSLWDO/HDVH 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG /HVV$FFXPXODWHG'HSUHFLDWLRQIRU /DQG,PSURYHPHQWVDQG*ROI&RXUVH %XLOGLQJVDQG6WUXFWXUHV )XUQLWXUHDQG2IILFH(TXLSPHQW 9HKLFOHVDQG(TXLSPHQW 8WLOLW\LQIUDVWUXFWXUH /HDVH3URSHUW\&DSLWDO/HDVH 7RWDO$FFXPXODWHG'HSUHFLDWLRQ 7RWDO&DSLWDO$VVHWV%HLQJ'HSUHFLDWHG1HW %XVLQHVV7\SH$FWLYLWLHV&DSLWDO$VVHWV1HW 'HSUHFLDWLRQH[SHQVHZDVFKDUJHGWRIXQFWLRQVSURJUDPVRIWKHSULPDU\JRYHUQPHQWDVIROORZV *RYHUQPHQWDO$FWLYLWLHV *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV7RWDO'HSUHFLDWLRQ([SHQVH*RYHUQPHQWDO$FWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV 8WLOLWLHV /LTXRU$TXDWLF&HQWHU*ROI&RXUVH $UHQD$UW&HQWHU (GLQERURXJK3DUN&HQWHQQLDO/DNHV6SRUWV'RPH 7RWDO'HSUHFLDWLRQ([SHQVH%XVLQHVV7\SH$FWLYLWLHV A-30 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &$3,7$/$66(76 &217,18(' &RQVWUXFWLRQ&RPPLWPHQWV$W 'HFHPEHU WKH &LW\ KDG FRQVWUXFWLRQ SURMHFW FRQWUDFWV LQ SURJUHVV 7KHFRPPLWPHQWVUHODWHGWRWKHUHPDLQLQJFRQWUDFWEDODQFHVDUHVXPPDUL]HGDVIROORZV &RQWUDFW5HPDLQLQJ3URMHFW3URMHFW'HVFULSWLRQ$PRXQW &RPPLWPHQW(1*&UHHN.QROO$ % (1*0HORG\/DNH$%*UDQGYLHZ$%LUFKFUHVW&(1*(GHQ$YH %URRNVLGH(1*+LJKODQGV3DUN7UDLO,PSURYHPHQWV (1*7RZQHV5RDG6XPS'UDLQ (1**93HGHVWULDQ%ULGJH 7RWDO &RPPLWPHQWV DERYH WKDW DUH VLJQLILFDQW WR WKH DSSOLFDEOH IXQG LQFOXGH WKH (GHQ $YH %URRNVLGH3URMHFWLQWKH+5$IXQGWKH*UDQGYLHZ3HGHVWULDQ%ULGJHLQWKH+5$IXQGDQGWKH0HORG\/DNH$%*UDQGYLHZ$DQG%LUFKFUHVW&SURMHFWLQWKH3,5&RQVWUXFWLRQIXQGDQGWKH8WLOLWLHVIXQG127( /21*7(50'(%77KH &LW\ KDV ILYH W\SHV RI ERQGHG GHEW RXWVWDQGLQJ DW 'HFHPEHU JHQHUDOREOLJDWLRQERQGVSHUPDQHQWLPSURYHPHQWUHYROYLQJERQGVWD[LQFUHPHQWILQDQFLQJERQGVSXEOLF SURMHFW UHYHQXH ERQGV DQG *2 UHYHQXH ERQGV 7KH ILUVWW\SHLVSD\DEOHIURPJHQHUDOSURSHUW\WD[HV7KHVHFRQGW\SHLVSD\DEOHSULPDULO\IURPVSHFLDODVVHVVPHQWVZLWKDQ\GHILFLHQF\WREHSURYLGHGIRUE\JHQHUDOSURSHUW\WD[HV7KHWKLUGW\SHLVSD\DEOHIURPIXWXUH WD[ LQFUHPHQW SD\PHQWV UHFHLYHG 7KH IRXUWK W\SH LV SD\DEOH VROHO\ IURP DQQXDODSSURSULDWLRQOHDVHSD\PHQWVUHFHLYHGIURPWKH&LW\RI(GLQDSXUVXDQWWRDOHDVHEHWZHHQWKH (GLQD +RXVLQJ DQG 5HGHYHORSPHQW $XWKRULW\ DQG WKH &LW\ 7KH ILIWK W\SH LV SD\DEOHSULPDULO\IURPHQWHUSULVHUHYHQXHZLWKDQ\GHILFLHQF\WREHSURYLGHGIRUE\JHQHUDOSURSHUW\WD[HV7KHUHSRUWLQJHQWLW\¶VORQJWHUPGHEWLVVHJUHJDWHGEHWZHHQWKHDPRXQWVWREHUHSDLGIURPJRYHUQPHQWDODFWLYLWLHVDQGDPRXQWVWREHUHSDLGIURPEXVLQHVVW\SHDFWLYLWLHV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( /21*7(50'(%7 &217,18(' *RYHUQPHQWDO$FWLYLWLHV$V RI 'HFHPEHU WKH JRYHUQPHQWDO ORQJWHUP ERQGHG GHEW RI WKH ILQDQFLDOUHSRUWLQJHQWLW\FRQVLVWHGRIWKHIROORZLQJ )LQDO,QWHUHVW,VVXH0DWXULW\ 2ULJLQDO 3D\DEOH5DWHV'DWH'DWH,VVXH *HQHUDO2EOLJDWLRQ%RQGV *HQHUDO2EOLJDWLRQ&DSLWDO,PSURYHPHQW3ODQ$5HIXQGLQJ *HQHUDO2EOLJDWLRQ$5HIXQGLQJ *HQHUDO2EOLJDWLRQ&5HIXQGLQJ *HQHUDO2EOLJDWLRQ(TXLSPHQW&HUWLILFDWH $ *HQHUDO2EOLJDWLRQ%5HIXQGLQJ 7RWDO*HQHUDO2EOLJDWLRQ%RQGV 3HUPDQHQW,PSURYHPHQW5HYROYLQJ 3,5 %RQGV 3HUPDQHQW,PSURYHPHQW5HYROYLQJ% 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$3DUNLQJ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ $ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ% 3HUPDQHQW,PSURYHPHQW5HYROYLQJ$ 3HUPDQHQW,PSURYHPHQW5HYROYLQJ% 7RWDO3,5%RQGV 7D[,QFUHPHQW)LQDQFLQJ%RQGV7D[,QFUHPHQW)LQDQFLQJ$ 3XEOLF3URMHFW5HYHQXH%RQGV 3XEOLF3URMHFW5HYHQXH$ 3XEOLF3URMHFW5HYHQXH$5HIXQGLQJ 7RWDO3XEOLF3URMHFW5HYHQXH%RQGV 7RWDO%RQGHG,QGHEWHGQHVV*RYHUQPHQWDO$FWLYLWLHV A-31 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( /21*7(50'(%7 &217,18(' %XVLQHVV7\SH$FWLYLWLHV)LQDO,QWHUHVW,VVXH0DWXULW\ 2ULJLQDO 3D\DEOH5DWHV'DWH'DWH,VVXH 5HYHQXH%RQGV 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV& 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV'5HIXQGLQJ 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV&5HIXQGLQJ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV $ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV%5HIXQGLQJ 7RWDO%RQGHG,QGHEWHGQHVV%XVLQHVV7\SH$FWLYLWLHV $QQXDOGHEWVHUYLFHUHTXLUHPHQWVWRPDWXULW\IRUWKH&LW\¶VERQGVDUHDVIROORZV <HDU(QGLQJ'HFHPEHU3ULQFLSDO,QWHUHVW3ULQFLSDO,QWHUHVW3ULQFLSDO,QWHUHVW 7RWDO *HQHUDO3XEOLF,PSURYHPHQW3XEOLF3URMHFW*RYHUQPHQWDO$FWLYLWLHV2EOLJDWLRQ%RQGV5HYROYLQJ%RQGV5HYHQXH%RQGV<HDU(QGLQJ'HFHPEHU3ULQFLSDO,QWHUHVW3ULQFLSDO,QWHUHVW 7RWDO*RYHUQPHQWDO$FWLYLWLHV7D[,QFUHPHQW)LQDQFLQJ%RQGV%XVLQHVV7\SH$FWLYLWLHV5HYHQXH%RQGV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( /21*7(50'(%7 &217,18(' &KDQJHLQ/RQJ7HUP/LDELOLWLHV/RQJWHUPOLDELOLW\DFWLYLW\IRUWKH\HDUHQGHG'HFHPEHUZDVDVIROORZV %HJLQQLQJ(QGLQJ 'XH:LWKLQ%DODQFH $GGLWLRQV 5HGXFWLRQV %DODQFH2QH<HDU*RYHUQPHQWDO$FWLYLWLHV %RQGV3D\DEOH *HQHUDO2EOLJDWLRQ 3,5 3XEOLF3URMHFW5HYHQXH 7D[,QFUHPHQW)LQDQFLQJ /HVV'HIHUUHG$PRXQWV 3UHPLXPVRQ%RQGV 7RWDO%RQGV3D\DEOH /RDQV3D\DEOH &RPSHQVDWHG$EVHQFHV *RYHUQPHQWDO$FWLYLW\/RQJ7HUP/LDELOLWLHV %XVLQHVV7\SH$FWLYLWLHV %RQGV3D\DEOH *HQHUDO2EOLJDWLRQ5HYHQXH%RQG /HVV'HIHUUHG$PRXQWV 3UHPLXPVRQ%RQGV 7RWDO%RQGV3D\DEOH &RPSHQVDWHG$EVHQFHV %XVLQHVV7\SH$FWLYLW\/RQJ7HUP/LDELOLWLHV )RUJRYHUQPHQWDODFWLYLWLHVFRPSHQVDWHGDEVHQFHVDUHJHQHUDOO\OLTXLGDWHGE\WKHJHQHUDOIXQG2Q -XQH WKH &LW\ LVVXHG RI *HQHUDO 2EOLJDWLRQ 3,5 %RQGV DQGRI*HQHUDO2EOLJDWLRQ7,)%RQGV6HULHV$7KHSURFHHGVRIWKHVHERQGVDUHEHLQJXVHGWRILQDQFHYDULRXVDVVHVVDEOHSXEOLFLPSURYHPHQWVDQGWKHFRQVWUXFWLRQRISXEOLFLPSURYHPHQWVZLWKLQWKH*UDQGYLHZ7D[,QFUHPHQW)LQDQFLQJ'LVWULFWLQWKH&LW\7KHERQGVLQFOXGHFRXSRQUDWHVRIZLWKDILQDOPDWXULW\GDWHRI)HEUXDU\IRUWKH3,5SRUWLRQRIWKHERQGVDQG)HEUXDU\IRUWKH7,)SRUWLRQRIWKHERQGV2Q'HFHPEHUWKH&LW\LVVXHGRI*HQHUDO2EOLJDWLRQ5HIXQGLQJ%RQGVDQG RI *HQHUDO 2EOLJDWLRQ 3,5 5HIXQGLQJ%RQGV6HULHV % WR DGYDQFHUHIXQGLQWKHWKURXJKPDWXULWLHVRIWKH&LW\¶VRXWVWDQGLQJ$ERQGV7KHERQGVLQFOXGHFRXSRQUDWHVRIZLWKDILQDOPDWXULW\GDWHRI)HEUXDU\2Q 'HFHPEHU WKH &LW\ LVVXHG RI *HQHUDO 2EOLJDWLRQ 5HFUHDWLRQDO5HYHQXH5HIXQGLQJ%RQGV6HULHV&WRDGYDQFHUHIXQGLQWKHWKURXJKPDWXULWLHVRIWKH&LW\¶VRXWVWDQGLQJ&ERQGV7KHERQGVLQFOXGHFRXSRQUDWHVRIZLWKDILQDOPDWXULW\GDWHRI)HEUXDU\ IRUWKHJROIFRXUVHSRUWLRQDQG)HEUXDU\IRUWKHLFHDUHQDSRUWLRQA-32 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( /21*7(50'(%7 &217,18(' 2Q)HEUXDU\WKH&LW\XVHGSURFHHGVIURPWKH%*HQHUDO2EOLJDWLRQ5HIXQGLQJ%RQGVWRFDOOWKH$*HQHUDO2EOLJDWLRQ3,5DQG8WLOLW\5HYHQXHERQGV7KHUHIXQGLQJUHVXOWHGLQDFDVKIORZVDYLQJVRI DQGDQHWSUHVHQWYDOXHVDYLQJVRI5HYHQXH3OHGJHG)XWXUHUHYHQXHSOHGJHGIRUWKHSD\PHQWRIORQJWHUPGHEWLVDVIROORZV 3HUFHQWRI5HPDLQLQJ 3ULQFLSDO 3OHGJHG7RWDO'HEW 7HUPVRI 3ULQFLSDO DQG,QWHUHVW 5HYHQXH%RQG,VVXH8VHRI3URFHHGV 7\SH 6HUYLFH 3OHGJH DQG,QWHUHVW 3DLG 5HFHLYHG&5HFUHDWLRQDO)DFLOLW\%RQGV $UHQD,PSURYHPHQWV$UHQD %5HFUHDWLRQDO)DFLOLW\%RQGV *ROI'RPH,PSURYHPHQWV *ROI %5HFUHDWLRQDO)DFLOLW\%RQGV *ROI&RXUVH,PSURYHPHQWV *ROI %5HFUHDWLRQDO)DFLOLW\%RQGV *ROI&RXUVH,PSURYHPHQWV *ROI %5HFUHDWLRQDO)DFLOLW\%RQGV 3RRO,PSURYHPHQWV 3RRO '5HFUHDWLRQDO)DFLOLW\%RQGV $UHQD,PSURYHPHQWV$UHQD &5HFUHDWLRQDO)DFLOLW\%RQGV $UHQD,PSURYHPHQWV$UHQD &5HFUHDWLRQDO)DFLOLW\%RQGV *ROI'RPH,PSURYHPHQWV *ROI $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ $8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ %8WLOLW\5HYHQXH%RQGV 8WLOLW\,QIUDVWUXFWXUH8WLOLW\ 5HYHQXH3OHGJHG&XUUHQW<HDU127( /(*$/'(%70$5*,17KH &LW\ LV VXEMHFW WR D VWDWXWRU\ OLPLWDWLRQ E\ WKH VWDWH RI 0LQQHVRWD IRU ERQGHGLQGHEWHGQHVVSD\DEOHSULQFLSDOO\IURPSURSHUW\WD[HV7KH&LW\RI(GLQD¶VOHJDOGHEWPDUJLQIRULVFRPSXWHGDVIROORZV 'HFHPEHU0DUNHW9DOXH $IWHU)LVFDO'LVSDULWLHV 'HEW/LPLW RI0DUNHW9DOXH $PRXQWRI'HEW$SSOLFDEOHWR'HEW/LPLW 7RWDO%RQGHG'HEW /HVV 3XEOLF,PSURYHPHQW5HYROYLQJ%RQGV 7D[,QFUHPHQW)LQDQFLQJ%RQGV 5HYHQXH%RQGV 7RWDO'HEW$SSOLFDEOHWR'HEW/LPLW/HJDO'HEW0DUJLQ&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'(7KH&LW\SDUWLFLSDWHVLQYDULRXVSHQVLRQSODQVZLWKWRWDOSHQVLRQH[SHQVHIRUWKH\HDUHQGHG'HFHPEHURI7KHFRPSRQHQWVRISHQVLRQH[SHQVHDUHQRWHGLQWKHIROORZLQJSODQVXPPDULHV $ 3ODQ'HVFULSWLRQ7KH &LW\ SDUWLFLSDWHV LQ WKH IROORZLQJ FRVWVKDULQJ PXOWLSOHHPSOR\HU GHILQHG EHQHILWSHQVLRQ SODQV DGPLQLVWHUHG E\ WKH 3XEOLF (PSOR\HHV 5HWLUHPHQW $VVRFLDWLRQ RI0LQQHVRWD 3(5$ 3(5$¶V GHILQHG EHQHILW SHQVLRQ SODQV DUH HVWDEOLVKHG DQGDGPLQLVWHUHGLQDFFRUGDQFHZLWK0LQQHVRWD6WDWXWHV&KDSWHUVDQG3(5$¶VGHILQHGEHQHILWSHQVLRQSODQVDUHWD[TXDOLILHGSODQVXQGHU6HFWLRQ D RIWKH,QWHUQDO5HYHQXH&RGH ,5& *HQHUDO(PSOR\HHV5HWLUHPHQW3ODQ$OOIXOOWLPHDQGFHUWDLQSDUWWLPHHPSOR\HHVRIWKH&LW\DUHFRYHUHGE\WKH*HQHUDO(PSOR\HHV3ODQ*HQHUDO(PSOR\HHV3ODQPHPEHUVEHORQJWRWKH&RRUGLQDWHG3ODQ&RRUGLQDWHG3ODQPHPEHUVDUHFRYHUHGE\6RFLDO6HFXULW\ 3XEOLF(PSOR\HHV3ROLFHDQG)LUH3ODQ7KH3ROLFHDQG)LUH3ODQRULJLQDOO\HVWDEOLVKHGIRUSROLFHRIILFHUVDQGILUHILJKWHUVQRWFRYHUHGE\DORFDOUHOLHIDVVRFLDWLRQQRZFRYHUVDOOSROLFHRIILFHUVDQGILUHILJKWHUVKLUHGVLQFH (IIHFWLYH-XO\ WKH3ROLFHDQG)LUH3ODQDOVRFRYHUVSROLFHRIILFHUVDQGILUHILJKWHUVEHORQJLQJWRORFDOUHOLHIDVVRFLDWLRQVWKDWHOHFWHGWRPHUJHZLWKDQGWUDQVIHUDVVHWVDQGDGPLQLVWUDWLRQWR3(5$% %HQHILWV3URYLGHG3(5$ SURYLGHV UHWLUHPHQW GLVDELOLW\ DQG GHDWK EHQHILWV %HQHILW SURYLVLRQV DUHHVWDEOLVKHGE\VWDWHVWDWXWHDQGFDQRQO\EHPRGLILHGE\WKHVWDWHOHJLVODWXUH9HVWHGWHUPLQDWHGHPSOR\HHVZKRDUHHQWLWOHGWREHQHILWVEXWDUHQRWUHFHLYLQJWKHP\HWDUHERXQGE\WKHSURYLVLRQVLQHIIHFWDWWKHWLPHWKH\ODVWWHUPLQDWHGWKHLUSXEOLFVHUYLFH *HQHUDO(PSOR\HHV3ODQ%HQHILWV*HQHUDO(PSOR\HHV3ODQEHQHILWVDUHEDVHGRQDPHPEHU¶VKLJKHVWDYHUDJHVDODU\IRU DQ\ ILYH VXFFHVVLYH \HDUV RIDOORZDEOH VHUYLFH DJH DQG \HDUV RI FUHGLW DWWHUPLQDWLRQ RI VHUYLFH 7ZR PHWKRGV DUH XVHG WR FRPSXWH EHQHILWV IRU 3(5$¶V&RRUGLQDWHG3ODQPHPEHUV0HPEHUVKLUHGSULRUWR-XO\ UHFHLYHWKHKLJKHURI0HWKRGRU0HWKRGIRUPXODV2QO\0HWKRGLVXVHGIRUPHPEHUVKLUHGDIWHU-XQH 8QGHU0HWKRGWKHDFFUXDOUDWHIRU&RRUGLQDWHGPHPEHUVLVIRUHDFKRIWKHILUVW\HDUVRIVHUYLFHDQGIRUHDFKDGGLWLRQDO\HDU8QGHU0HWKRGWKHDFFUXDOUDWHIRU&RRUGLQDWHGPHPEHUVLVIRUDOO\HDUVRIVHUYLFH)RUPHPEHUVKLUHGSULRUWR-XO\ DIXOODQQXLW\LVDYDLODEOHZKHQDJHSOXV\HDUVRIVHUYLFHHTXDO DQGQRUPDOUHWLUHPHQWDJHLV)RUPHPEHUVKLUHGRQRUDIWHU-XO\ QRUPDOUHWLUHPHQWDJHLVWKHDJHIRUXQUHGXFHG6RFLDO6HFXULW\EHQHILWVFDSSHGDWA-33 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' % %HQHILWV3URYLGHG &RQWLQXHG *HQHUDO(PSOR\HHV3ODQ%HQHILWV &RQWLQXHG %HQHILW LQFUHDVHV DUH SURYLGHG WR EHQHILW UHFLSLHQWV HDFK -DQXDU\ 7KHSRVWUHWLUHPHQW LQFUHDVH LV HTXDO WR RI WKH FRVWRIOLYLQJ DGMXVWPHQW &2/$ DQQRXQFHGE\WKH66$ZLWKDPLQLPXPLQFUHDVHRIDWOHDVWDQGDPD[LPXPRI5HFLSLHQWVWKDWKDYHEHHQUHFHLYLQJWKHDQQXLW\RUEHQHILWIRUDWOHDVWDIXOO\HDUDVRIWKH-XQHEHIRUHWKHHIIHFWLYHGDWHRIWKHLQFUHDVHZLOOUHFHLYHWKHIXOOLQFUHDVH5HFLSLHQWVUHFHLYLQJWKHDQQXLW\RUEHQHILWIRUDWOHDVWRQHPRQWKEXWOHVVWKDQDIXOO\HDUDVRIWKH-XQHEHIRUHWKHHIIHFWLYHGDWHRIWKHLQFUHDVHZLOOUHFHLYHDUHGXFHGSURUDWHGLQFUHDVH)RUPHPEHUVUHWLULQJRQ-DQXDU\RUODWHUWKHLQFUHDVHZLOOEHGHOD\HGXQWLOQRUPDOUHWLUHPHQWDJH DJHLIKLUHGSULRUWR-XO\ RUDJHIRULQGLYLGXDOVKLUHGRQRUDIWHU-XO\ 0HPEHUVUHWLULQJXQGHU5XOHRI DUHH[HPSWIURPWKHGHOD\WRQRUPDOUHWLUHPHQW 3ROLFHDQG)LUH3ODQ%HQHILWV%HQHILWVIRU3ROLFHDQG)LUH3ODQPHPEHUVILUVWKLUHGDIWHU-XQHEXWEHIRUH-XO\YHVWRQDSURUDWHGEDVLVIURPDIWHUILYH\HDUVXSWRDIWHUWHQ\HDUVRIFUHGLWHGVHUYLFH%HQHILWVIRU3ROLFHDQG)LUH3ODQPHPEHUVILUVWKLUHGDIWHU-XQHYHVWRQDSURUDWHGEDVLVIURPDIWHUWHQ\HDUVXSWRDIWHUWZHQW\\HDUVRIFUHGLWHGVHUYLFH7KHDQQXLW\DFFUXDOUDWHLVRIDYHUDJHVDODU\IRUHDFK\HDURIVHUYLFH)RU3ROLFHDQG)LUH3ODQPHPEHUVZKRZHUHILUVWKLUHGSULRUWR-XO\ DIXOODQQXLW\LVDYDLODEOHZKHQDJHSOXV\HDUVRIVHUYLFHHTXDODWOHDVW %HQHILW LQFUHDVHV DUH SURYLGHG WR EHQHILW UHFLSLHQWV HDFK -DQXDU\ 7KHSRVWUHWLUHPHQW LQFUHDVH LV IL[HG DW 5HFLSLHQWV WKDW KDYH EHHQ UHFHLYLQJ WKHDQQXLW\RUEHQHILWIRUDWOHDVWPRQWKVDVRIWKH-XQHEHIRUHWKHHIIHFWLYHGDWHRIWKHLQFUHDVHZLOOUHFHLYHWKHIXOOLQFUHDVH5HFLSLHQWVUHFHLYLQJWKHDQQXLW\RUEHQHILWIRUDWOHDVWPRQWKVEXWOHVVWKDQPRQWKVDVRIWKH-XQHEHIRUHWKHHIIHFWLYHGDWHRIWKHLQFUHDVHZLOOUHFHLYHDUHGXFHGSURUDWHGLQFUHDVH&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' & &RQWULEXWLRQV0LQQHVRWD 6WDWXWHV &KDSWHU VHWV WKH UDWHV IRU HPSOR\HU DQG HPSOR\HHFRQWULEXWLRQV&RQWULEXWLRQUDWHVFDQRQO\EHPRGLILHGE\WKHVWDWHOHJLVODWXUH *HQHUDO(PSOR\HHV)XQG&RQWULEXWLRQV&RRUGLQDWHG 3ODQ PHPEHUV ZHUH UHTXLUHG WR FRQWULEXWH RI WKHLU DQQXDOFRYHUHGVDODU\LQILVFDO\HDUDQGWKH&LW\ZDVUHTXLUHGWRFRQWULEXWHIRU&RRUGLQDWHG3ODQPHPEHUV7KH&LW\¶VFRQWULEXWLRQVWRWKH*HQHUDO(PSOR\HHV)XQGIRUWKH\HDUHQGHG'HFHPEHUZHUH 7KH&LW\¶VFRQWULEXWLRQVZHUHHTXDOWRWKHUHTXLUHGFRQWULEXWLRQVDVVHWE\VWDWHVWDWXWH 3ROLFHDQG)LUH)XQG&RQWULEXWLRQV3ROLFHDQG)LUH3ODQPHPEHUVZHUHUHTXLUHGWRFRQWULEXWHRIWKHLUDQQXDOFRYHUHGVDODU\LQILVFDO\HDUDQGWKH&LW\ZDVUHTXLUHGWRFRQWULEXWHIRU3ROLFHDQG)LUH3ODQPHPEHUV7KH&LW\¶VFRQWULEXWLRQVWRWKH3ROLFHDQG)LUH)XQGIRUWKH\HDUHQGHG'HFHPEHUZHUH7KH&LW\¶VFRQWULEXWLRQVZHUHHTXDOWRWKHUHTXLUHGFRQWULEXWLRQVDVVHWE\VWDWHVWDWXWH' 3HQVLRQ&RVWV *HQHUDO(PSOR\HHV)XQG3HQVLRQ&RVWV$W 'HFHPEHU WKH &LW\ UHSRUWHG D OLDELOLW\ RI IRU LWVSURSRUWLRQDWHVKDUHRIWKH*HQHUDO(PSOR\HHV)XQG¶VQHWSHQVLRQOLDELOLW\7KH&LW\¶VQHWSHQVLRQOLDELOLW\UHIOHFWHGDUHGXFWLRQGXHWRWKHVWDWHRI0LQQHVRWD¶VFRQWULEXWLRQRI PLOOLRQ 7KH VWDWH RI 0LQQHVRWD LV FRQVLGHUHG D QRQHPSOR\HU FRQWULEXWLQJHQWLW\DQGWKHVWDWH¶VFRQWULEXWLRQPHHWVWKHGHILQLWLRQRIDVSHFLDOIXQGLQJVLWXDWLRQ7KHVWDWHRI0LQQHVRWD¶VSURSRUWLRQDWHVKDUHRIWKHQHWSHQVLRQOLDELOLW\DVVRFLDWHGZLWKWKH&LW\WRWDOHG 7KHQHWSHQVLRQOLDELOLW\ZDVPHDVXUHGDVRI-XQHDQGWKHWRWDOSHQVLRQOLDELOLW\ XVHGWR FDOFXODWHWKH QHW SHQVLRQ OLDELOLW\ ZDV GHWHUPLQHGE\DQDFWXDULDOYDOXDWLRQDVRIWKDWGDWH7KH&LW\¶VSURSRUWLRQDWHVKDUHRIWKHQHWSHQVLRQOLDELOLW\ZDVEDVHGRQWKH&LW\¶VFRQWULEXWLRQVUHFHLYHGE\3(5$GXULQJWKHPHDVXUHPHQWSHULRGIRUHPSOR\HUSD\UROOSDLGGDWHVIURP-XO\WKURXJK-XQHUHODWLYHWRWKHWRWDOHPSOR\HUFRQWULEXWLRQVUHFHLYHGIURPDOORI3(5$¶VSDUWLFLSDWLQJHPSOR\HUV 7KH &LW\¶V SURSRUWLRQDWH VKDUH ZDV DW WKH HQG RI WKHPHDVXUHPHQWSHULRGDQGIRUWKHEHJLQQLQJRIWKHSHULRGA-34 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' ' 3HQVLRQ&RVWV &RQWLQXHG *HQHUDO(PSOR\HHV)XQG3HQVLRQ&RVWV &RQWLQXHG &LW\ V3URSRUWLRQDWH6KDUHRIWKH1HW3HQVLRQ/LDELOLW\ 6WDWHRI0LQQHVRWD V3URSRUWLRQDWH6KDUHRIWKH1HW3HQVLRQ/LDELOLW\$VVRFLDWHGZLWKWKH&LW\ 7RWDO )RUWKH\HDUHQGHG'HFHPEHUWKH&LW\UHFRJQL]HGSHQVLRQH[SHQVHRI IRU LWV SURSRUWLRQDWH VKDUH RI WKH *HQHUDO (PSOR\HHV 3ODQ¶V SHQVLRQH[SHQVH,QDGGLWLRQWKH&LW\UHFRJQL]HGDQDGGLWLRQDODVSHQVLRQH[SHQVH DQG JUDQW UHYHQXH IRU LWV SURSRUWLRQDWH VKDUH RI WKH VWDWH RI 0LQQHVRWD¶VFRQWULEXWLRQRIPLOOLRQWRWKH*HQHUDO(PSOR\HHV)XQG$W 'HFHPEHU WKH &LW\ UHSRUWHG LWV SURSRUWLRQDWH VKDUHRIWKH*HQHUDO(PSOR\HHV3ODQ¶VGHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVIURPWKHIROORZLQJVRXUFHV 'HIHUUHG'HIHUUHG2XWIORZV,QIORZVRI5HVRXUFHV RI5HVRXUFHV'LIIHUHQFHV%HWZHHQ([SHFWHGDQG$FWXDO(FRQRPLF([SHULHQFH &KDQJHVLQ$FWXDULDO$VVXPSWLRQV 'LIIHUHQFHV%HWZHHQ3URMHFWHGDQG$FWXDO,QYHVWPHQW(DUQLQJV &KDQJHVLQ3URSRUWLRQ &RQWULEXWLRQV3DLGWRWKH3(5$6XEVHTXHQWWRWKH0HDVXUHPHQW'DWH 7RWDO UHSRUWHGDVGHIHUUHGRXWIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVUHVXOWLQJIURPFLW\FRQWULEXWLRQVVXEVHTXHQWWRWKHPHDVXUHPHQWGDWHWKDWZLOOEHUHFRJQL]HGDV D UHGXFWLRQ RIWKH QHW SHQVLRQ OLDELOLW\ LQWKH \HDU HQGHG 'HFHPEHU 2WKHU DPRXQWV UHSRUWHG DV GHIHUUHG RXWIORZV DQG LQIORZV RIUHVRXUFHV UHODWHG WRSHQVLRQVZLOOEHUHFRJQL]HGLQSHQVLRQH[SHQVHDVIROORZV 3HQVLRQ([SHQVH<HDU(QGLQJ'HFHPEHU$PRXQW &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' ' 3HQVLRQ&RVWV &RQWLQXHG 3ROLFHDQG)LUH)XQG3HQVLRQ&RVWV$W'HFHPEHUWKH&LW\UHSRUWHGDOLDELOLW\RIIRULWVSURSRUWLRQDWHVKDUHRIWKH3ROLFHDQG)LUH)XQG¶VQHWSHQVLRQOLDELOLW\7KHQHWSHQVLRQOLDELOLW\ZDVPHDVXUHGDVRI-XQHDQGWKHWRWDOSHQVLRQOLDELOLW\XVHGWRFDOFXODWHWKHQHWSHQVLRQOLDELOLW\ZDVGHWHUPLQHGE\DQDFWXDULDOYDOXDWLRQDVRIWKDWGDWH7KH&LW\¶V SURSRUWLRQDWH VKDUH RI WKH QHW SHQVLRQ OLDELOLW\ ZDV EDVHG RQ WKH &LW\¶VFRQWULEXWLRQVUHFHLYHGE\3(5$GXULQJWKHPHDVXUHPHQWSHULRGIRUHPSOR\HUSD\UROOSDLGGDWHVIURP-XO\WKURXJK-XQHUHODWLYHWRWKHWRWDOHPSOR\HUFRQWULEXWLRQV UHFHLYHG IURP DOO RI 3(5$¶V SDUWLFLSDWLQJ HPSOR\HUV 7KH &LW\¶VSURSRUWLRQDWH VKDUH ZDV DW WKH HQG RI WKH PHDVXUHPHQW SHULRG DQGIRUWKHEHJLQQLQJRIWKHSHULRG7KHVWDWHRI0LQQHVRWDFRQWULEXWHGPLOOLRQWRWKH3ROLFHDQG)LUH)XQGLQWKHSODQILVFDO\HDUHQGHG-XQH7KHFRQWULEXWLRQFRQVLVWHGRI PLOOLRQLQGLUHFWVWDWHDLGWKDWGRHVPHHWWKHGHILQLWLRQRIDVSHFLDOIXQGLQJVLWXDWLRQDQG PLOOLRQLQVXSSOHPHQWDO VWDWH DLG WKDW GRHV QRW PHHW WKH GHILQLWLRQ RI D VSHFLDO IXQGLQJVLWXDWLRQ7KH PLOOLRQGLUHFWVWDWHZDVSDLGRQ2FWREHU7KHUHDIWHUE\2FWREHURIHDFK\HDUWKHVWDWHZLOOSD\ PLOOLRQWRWKH3ROLFHDQG)LUH)XQGXQWLOIXOO IXQGLQJ LV UHDFKHG RU -XO\ ZKLFKHYHU LV HDUOLHU7KH PLOOLRQ LQVXSSOHPHQWDOVWDWHDLGZLOOFRQWLQXHXQWLOWKHIXQGLV IXQGHGRUXQWLOWKH6WDWH3DWURO 3ODQ DGPLQLVWHUHG E\ WKH 0LQQHVRWD 6WDWH 5HWLUHPHQW 6\VWHP LV IXQGHGZKLFKHYHURFFXUVODWHU6WURQJDVVHWUHWXUQVIRUWKHILVFDO\HDUHQGHGZLOO DFFHOHUDWH WKH SKDVLQJ RXW RI WKHVH VWDWH FRQWULEXWLRQV DOWKRXJK ZH GR QRWDQWLFLSDWHWKHPWREHSKDVHGRXWGXULQJWKHILVFDO\HDUHQGLQJ7KHVWDWHRI0LQQHVRWDLVLQFOXGHGDVDQRQHPSOR\HUFRQWULEXWLQJHQWLW\LQWKH3ROLFHDQG )LUH 5HWLUHPHQW 3ODQ 6FKHGXOH RI (PSOR\HU $OORFDWLRQV DQG 6FKHGXOH RI3HQVLRQ$PRXQWVE\(PSOR\HU&XUUHQW5HSRUWLQJ3HULRG2QO\ SHQVLRQDOORFDWLRQVFKHGXOHV IRUWKH PLOOLRQLQGLUHFWVWDWHDLG3ROLFHDQG)LUH3ODQHPSOR\HUVQHHGWRUHFRJQL]HWKHLUSURSRUWLRQDWHVKDUHRIWKHVWDWHRI0LQQHVRWD¶VSHQVLRQH[SHQVH DQG JUDQW UHYHQXH XQGHU *$6% VSHFLDO IXQGLQJ VLWXDWLRQ DFFRXQWLQJ DQGILQDQFLDO UHSRUWLQJ UHTXLUHPHQWV )RU WKH \HDU HQGHG -XQH WKH &LW\UHFRJQL]HGSHQVLRQH[SHQVHRI IRULWVSURSRUWLRQDWHVKDUHRIWKH3ROLFHDQG)LUH3ODQ¶VSHQVLRQH[SHQVH7KH&LW\UHFRJQL]HG DVJUDQWUHYHQXHIRULWV SURSRUWLRQDWH VKDUH RI WKH VWDWH RI 0LQQHVRWD¶V SHQVLRQ H[SHQVH IRU WKHFRQWULEXWLRQRI PLOOLRQWRWKH3ROLFHDQG)LUH)XQGA-35 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' ' 3HQVLRQ&RVWV &RQWLQXHG 3ROLFHDQG)LUH3ODQ3HQVLRQ&RVWV &RQWLQXHG 7KHVWDWHRI0LQQHVRWDLVQRWLQFOXGHGDVDQRQHPSOR\HUFRQWULEXWLQJHQWLW\LQWKH3ROLFH DQG )LUH 3HQVLRQ 3ODQ SHQVLRQ DOORFDWLRQ VFKHGXOHV IRU WKH PLOOLRQ LQVXSSOHPHQWDO VWDWH DLG 7KH &LW\ UHFRJQL]HG IRU WKH \HDU HQGHG'HFHPEHUDVUHYHQXHDQGDQRIIVHWWLQJUHGXFWLRQRIQHWSHQVLRQOLDELOLW\IRULWV SURSRUWLRQDWH VKDUH RI WKH VWDWH RI 0LQQHVRWD¶V RQEHKDOI FRQWULEXWLRQV WR WKH3ROLFHDQG)LUH)XQG&LW\ V3URSRUWLRQDWH6KDUHRIWKH1HW3HQVLRQ/LDELOLW\ 6WDWHRI0LQQHVRWD V3URSRUWLRQDWH6KDUHRIWKH1HW3HQVLRQ/LDELOLW\$VVRFLDWHGZLWKWKH&LW\ 7RWDO $W'HFHPEHUWKH&LW\UHSRUWHGLWVSURSRUWLRQDWHVKDUHRIWKH3ROLFHDQG)LUH3ODQ¶VGHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVIURPWKHIROORZLQJVRXUFHV 'HIHUUHG'HIHUUHG2XWIORZV,QIORZVRI5HVRXUFHV RI5HVRXUFHV'LIIHUHQFHV%HWZHHQ([SHFWHGDQG$FWXDO(FRQRPLF([SHULHQFH&KDQJHVLQ$FWXDULDO$VVXPSWLRQV 'LIIHUHQFHV%HWZHHQ3URMHFWHGDQG$FWXDO,QYHVWPHQW(DUQLQJV&KDQJHVLQ3URSRUWLRQ &RQWULEXWLRQV3DLGWRWKH3(5$6XEVHTXHQWWRWKH0HDVXUHPHQW'DWH 7RWDO UHSRUWHGDVGHIHUUHGRXWIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVUHVXOWLQJIURPFLW\FRQWULEXWLRQVVXEVHTXHQWWRWKHPHDVXUHPHQWGDWHZLOOEHUHFRJQL]HGDVDUHGXFWLRQRIWKHQHWSHQVLRQOLDELOLW\LQWKH\HDUHQGHG'HFHPEHU2WKHUDPRXQWVUHSRUWHGDVGHIHUUHGRXWIORZVDQGLQIORZVRIUHVRXUFHVUHODWHGWRSHQVLRQVZLOOEHUHFRJQL]HGLQSHQVLRQH[SHQVHDVIROORZV 3HQVLRQ([SHQVH<HDU(QGLQJ'HFHPEHU$PRXQW &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' ( /RQJ7HUP([SHFWHG5HWXUQRQ,QYHVWPHQW7KH6WDWH%RDUGRI,QYHVWPHQWZKLFKPDQDJHVWKHLQYHVWPHQWVRI3(5$SUHSDUHVDQDQDO\VLV RI WKH UHDVRQDEOHQHVV RQ D UHJXODU EDVLV RIWKH ORQJWHUPH[SHFWHGUDWHRIUHWXUQXVLQJDEXLOGLQJEORFNPHWKRGLQZKLFKEHVWHVWLPDWHUDQJHVRIH[SHFWHGIXWXUHUDWHVRIUHWXUQDUHGHYHORSHGIRUHDFKPDMRUDVVHWFODVV7KHVHUDQJHVDUHFRPELQHGWRSURGXFHDQH[SHFWHGORQJWHUPUDWHRIUHWXUQE\ZHLJKWLQJWKHH[SHFWHGIXWXUHUDWHVRIUHWXUQ E\ WKH WDUJHW DVVHW DOORFDWLRQ SHUFHQWDJHV 7KH WDUJHW DOORFDWLRQ DQG EHVWHVWLPDWHVRIJHRPHWULFUHDOUDWHVRIUHWXUQIRUHDFKPDMRUDVVHWFODVVDUHVXPPDUL]HGLQWKHIROORZLQJWDEOH /RQJ7HUP7DUJHW([SHFWHG5HDO$VVHW&ODVV $OORFDWLRQ 5DWHRI5HWXUQ'RPHVWLF(TXLW\ ,QWHUQDWLRQDO(TXLW\ )L[HG,QFRPH 3ULYDWH0DUNHWV ) $FWXDULDO$VVXPSWLRQV7KHWRWDOSHQVLRQOLDELOLW\LQWKH-XQHDFWXDULDOYDOXDWLRQZDVGHWHUPLQHGXVLQJDQLQGLYLGXDOHQWU\DJHQRUPDODFWXDULDOFRVWPHWKRG7KHORQJWHUPUDWHRIUHWXUQRQSHQVLRQSODQLQYHVWPHQWVXVHGLQWKHGHWHUPLQDWLRQRIWKHWRWDOOLDELOLW\LV7KLVDVVXPSWLRQLVEDVHGRQDUHYLHZRILQIODWLRQDQGLQYHVWPHQWVUHWXUQDVVXPSWLRQVIURPDQXPEHURIQDWLRQDOLQYHVWPHQWFRQVXOWLQJILUPV7KHUHYLHZSURYLGHGDUDQJHRIUHWXUQLQYHVWPHQWUHWXUQUDWHVGHHPHGWREHUHDVRQDEOHE\WKHDFWXDU\$QLQYHVWPHQWUHWXUQRIZDVGHHPHGWREHZLWKLQWKDWUDQJHRIUHDVRQDEOHQHVVIRUILQDQFLDOUHSRUWLQJSXUSRVHV,QIODWLRQLVDVVXPHGWREHIRUWKH*HQHUDO(PSOR\HHV3ODQDQGIRUWKH3ROLFHDQG)LUH3ODQ%HQHILWLQFUHDVHVDIWHUUHWLUHPHQWDUHDVVXPHGWREHIRUWKH*HQHUDO(PSOR\HHV3ODQ7KH3ROLFHDQG)LUH3ODQEHQHILWLQFUHDVHLVIL[HGDWSHU\HDUDQGWKDWLQFUHDVHZDVXVHGLQWKHYDOXDWLRQ6DODU\JURZWKDVVXPSWLRQVLQWKH*HQHUDO(PSOR\HHV3ODQUDQJHLQDQQXDOLQFUHPHQWVIURPDIWHURQH\HDURIVHUYLFHWRDIWHU \HDUVRIVHUYLFHDQGSHU\HDU WKHUHDIWHU ,Q WKH 3ROLFH DQG )LUH 3ODQ VDODU\ JURZWK DVVXPSWLRQV UDQJH IURPDIWHURQH\HDURIVHUYLFHWRDIWHU\HDUVRIVHUYLFH0RUWDOLW\UDWHVIRUWKH*HQHUDO(PSOR\HHV3ODQDUHEDVHGRQWKH 3XE*HQHUDO(PSOR\HH0RUWDOLW\7DEOH0RUWDOLW\UDWHVIRUWKH3ROLFHDQG)LUH3ODQDUHEDVHGRQWKH3XE3XEOLF6DIHW\(PSOR\HH0RUWDOLW\WDEOHV7KHWDEOHVDUHDGMXVWHGVOLJKWO\WRILW3(5$¶VH[SHULHQFHA-36 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' ) $FWXDULDO$VVXPSWLRQV &RQWLQXHG $FWXDULDODVVXPSWLRQVIRUWKH*HQHUDO(PSOR\HHV3ODQDUHUHYLHZHGHYHU\IRXU\HDUV7KH PRVW UHFHQW IRXU\HDU H[SHULHQFH VWXG\ IRU WKH *HQHUDO (PSOR\HHV 3ODQ ZDVFRPSOHWHGLQ 7KHDVVXPSWLRQFKDQJHVZHUHDGRSWHGE\WKH%RDUGDQGEHFDPHHIIHFWLYHZLWKWKH-XO\DFWXDULDOYDOXDWLRQ7KHPRVWUHFHQWIRXU\HDUH[SHULHQFHVWXGLHVIRUWKH3ROLFHDQG)LUHZHUHFRPSOHWHGLQZHUHDGRSWHGE\WKH%RDUGDQGEHFDPHHIIHFWLYHZLWKWKH-XO\DFWXDULDOYDOXDWLRQ7KHIROORZLQJFKDQJHVLQDFWXDULDODVVXPSWLRQVDQGSODQSURYLVLRQVRFFXUUHGLQ *HQHUDO(PSOR\HHV)XQG&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHLQYHVWPHQWUHWXUQDQGVLQJOHGLVFRXQWUDWHVZHUHFKDQJHGIURPWRIRUILQDQFLDOUHSRUWLQJSXUSRVHVx 7KH PRUWDOLW\ LPSURYHPHQW VFDOH ZDV FKDQJHG IURP 6FDOH03 WR 6FDOH033ROLFHDQG)LUH)XQG&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHLQYHVWPHQWUHWXUQDQGVLQJOHGLVFRXQWUDWHVZHUHFKDQJHGIURPWRIRUILQDQFLDOUHSRUWLQJSXUSRVHVx 7KHLQIODWLRQDVVXPSWLRQZDVFKDQJHGIURPWRx 7KHSD\UROOJURZWKDVVXPSWLRQZDVFKDQJHGIURPWRx 7KH EDVH PRUWDOLW\ WDEOH IRU KHDOWK\ DQQXLWDQWV DQG HPSOR\HHVZDV FKDQJHGIURP WKH 53 WDEOH WR WKH 3XE 3XEOLF 6DIHW\ 0RUWDOLW\WDEOH 7KHPRUWDOLW\LPSURYHPHQWVFDOHZDVFKDQJHGIURP03 WR01x 7KHEDVHPRUWDOLW\WDEOHIRUGLVDEOHGDQQXLWDQWVZDVFKDQJHGIURPWKH53KHDOWK\DQQXLWDQWPRUWDOLW\WDEOH ZLWKIXWXUHPRUWDOLW\LPSURYHPHQWDFFRUGLQJWR6FDOH03 WRWKH3XE3XEOLF6DIHW\GLVDEOHGDQQXLWDQWPRUWDOLW\WDEOH ZLWKIXWXUHPRUWDOLW\LPSURYHPHQWDFFRUGLQJWR6FDOH03 x $VVXPHGUDWHVRIVDODU\LQFUHDVHZHUHPRGLILHGDVUHFRPPHQGHGLQWKH-XO\H[SHULHQFHVWXG\7KHRYHUDOOLPSDFWLVDGHFUHDVHLQJURVVVDODU\LQFUHDVHUDWHVx $VVXPHG UDWHV RI UHWLUHPHQW ZHUH FKDQJHG DV UHFRPPHQGHG LQ WKH-XO\ H[SHULHQFH VWXG\ 7KH FKDQJHV UHVXOW LQ VOLJKWO\ PRUH XQUHGXFHGUHWLUHPHQWVDQGIHZHUDVVXPHGHDUO\UHWLUHPHQWVx $VVXPHGUDWHVRIZLWKGUDZDOZHUHFKDQJHGIURPVHOHFWDQGXOWLPDWH UDWHVWRVHUYLFHEDVHGUDWHV7KHFKDQJHVUHVXOWLQPRUHDVVXPHGWHUPLQDWLRQVx $VVXPHGUDWHVRIGLVDELOLW\ZHUHLQFUHDVHGIRUDJHV DQGGHFUHDVHGIRUDJHVRYHU 2YHUDOOSURSRVHGUDWHVUHVXOWLQPRUHSURMHFWHGGLVDELOLWLHVx $VVXPHGSHUFHQWPDUULHGIRUDFWLYHIHPDOHPHPEHUVZDVFKDQJHGIURPWR0LQRUFKDQJHVWRIRUPRISD\PHQWDVVXPSWLRQVZHUHDSSOLHG&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' * 'LVFRXQW5DWH7KHGLVFRXQWUDWHXVHGWRPHDVXUHWKHWRWDOSHQVLRQOLDELOLW\LQZDV7KHSURMHFWLRQRIFDVKIORZVXVHGWRGHWHUPLQHWKHGLVFRXQWUDWHDVVXPHGWKDWFRQWULEXWLRQVIURP SODQPHPEHUV DQG HPSOR\HUV ZLOO EH PDGH DWUDWHV VHW LQ 0LQQHVRWD 6WDWXWHV%DVHG RQ WKHVH DVVXPSWLRQV WKH ILGXFLDU\ QHW SRVLWLRQV RI WKH*HQHUDO (PSOR\HHV)XQG WKH 3ROLFH DQG )LUH )XQG DQG WKH &RUUHFWLRQDO )XQG ZHUHSURMHFWHG WR EHDYDLODEOH WR PDNH DOO SURMHFWHG IXWXUH EHQHILW SD\PHQWV RI FXUUHQW SODQ PHPEHUV7KHUHIRUH WKH ORQJWHUP H[SHFWHG UDWH RI UHWXUQ RQ SHQVLRQ SODQ LQYHVWPHQWV ZDVDSSOLHG WR DOO SHULRGV RI SURMHFWHG EHQHILW SD\PHQWV WR GHWHUPLQH WKH WRWDO SHQVLRQOLDELOLW\+ 3HQVLRQ/LDELOLW\6HQVLWLYLW\7KHIROORZLQJSUHVHQWVWKH&LW\¶VSURSRUWLRQDWHVKDUHRIWKHQHWSHQVLRQOLDELOLW\IRUDOOSODQV LW SDUWLFLSDWHV LQFDOFXODWHG XVLQJ WKH GLVFRXQWUDWH GLVFORVHG LQ WKH SUHFHGLQJSDUDJUDSKDVZHOODVZKDW WKH&LW\¶VSURSRUWLRQDWH VKDUHRIWKH QHWSHQVLRQOLDELOLW\ZRXOG EH LI LW ZHUH FDOFXODWHG XVLQJ D GLVFRXQW UDWH SHUFHQWDJH SRLQW ORZHU RUSHUFHQWDJHSRLQWKLJKHUWKDQWKHFXUUHQWGLVFRXQWUDWH 'HFUHDVHLQ,QFUHDVHLQ'LVFRXQW5DWH 'LVFRXQW5DWH 'LVFRXQW5DWH 7KH&LW\¶V3URSRUWLRQDWH6KDUHRIWKH*(5)1HW3HQVLRQ/LDELOLW\ 7KH&LW\¶V3URSRUWLRQDWH6KDUHRIWKH3(3))1HW3HQVLRQ/LDELOLW\ , 3HQVLRQ3ODQ)LGXFLDU\1HW3RVLWLRQ'HWDLOHGLQIRUPDWLRQDERXWHDFKSHQVLRQSODQ¶VILGXFLDU\QHWSRVLWLRQLVDYDLODEOHLQDVHSDUDWHO\LVVXHG3(5$ILQDQFLDOUHSRUWWKDWLQFOXGHVILQDQFLDOVWDWHPHQWVDQGUHTXLUHGVXSSOHPHQWDU\ LQIRUPDWLRQ 7KDW UHSRUW PD\ EH REWDLQHG RQ WKH 3(5$ ZHEVLWH DWZZZPQSHUDRUJ- 3XEOLF(PSOR\HHV'HILQHG&RQWULEXWLRQ3ODQ '&3 %RDUG PHPEHUV RI WKH &LW\ DUH FRYHUHG E\ WKH '&3 D PXOWLHPSOR\HU GHIHUUHGFRPSHQVDWLRQ SODQ DGPLQLVWHUHG E\ 3(5$ 7KH '&3 LV D WD[ TXDOLILHG SODQ XQGHU6HFWLRQ D RIWKH,5&DQGDOOFRQWULEXWLRQVE\RURQEHKDOIRIHPSOR\HHVDUHWD[GHIHUUHGXQWLOWLPHRIZLWKGUDZDO3ODQEHQHILWVGHSHQGVROHO\RQDPRXQWVFRQWULEXWHGWRWKHSODQSOXVLQYHVWPHQWHDUQLQJVOHVVDGPLQLVWUDWLYH H[SHQVHV0LQQHVRWD 6WDWXWHV&KDSWHU ' VSHFLILHV SODQ SURYLVLRQV LQFOXGLQJ WKH HPSOR\HH DQG HPSOR\HUFRQWULEXWLRQ UDWHV IRU WKRVH TXDOLILHG SHUVRQQHO ZKR HOHFW WR SDUWLFLSDWH $Q HOLJLEOHHOHFWHGRIILFLDOZKRGHFLGHVWRSDUWLFLSDWHFRQWULEXWHVRIVDODU\ZKLFKLVPDWFKHGE\WKHHOHFWHGRIILFLDO¶VHPSOR\HU)RUDPEXODQFHVHUYLFHSHUVRQQHOHPSOR\HUFRQWULEXWLRQVDUHGHWHUPLQHGE\WKHHPSOR\HUDQGIRUVDODULHGHPSOR\HHVPXVWEHDIL[HGSHUFHQWDJHRIVDODU\A-37 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( '(),1('%(1(),73(16,213/$16±67$7(:,'( &217,18(' - 3XEOLF(PSOR\HHV'HILQHG&RQWULEXWLRQ3ODQ '&3 &RQWLQXHG (PSOR\HUFRQWULEXWLRQVIRUYROXQWHHUSHUVRQQHOPD\EHDXQLWYDOXHIRUHDFKFDOORUSHULRGRIDOHUWGXW\(PSOR\HHVZKRDUHSDLGIRUWKHLUVHUYLFHVPD\HOHFWWRPDNHPHPEHUFRQWULEXWLRQVLQDQDPRXQWQRWWRH[FHHGWKHHPSOR\HUVKDUH(PSOR\HUDQGHPSOR\HHFRQWULEXWLRQVDUHFRPELQHGDQGXVHGWRSXUFKDVHVKDUHVLQRQHRUPRUHRIWKHVHYHQDFFRXQWVRIWKH0LQQHVRWD6XSSOHPHQWDO,QYHVWPHQW)XQG)RUDGPLQLVWHULQJWKHSODQ3(5$ UHFHLYHV RI HPSOR\HU FRQWULEXWLRQV DQG WZHQW\ILYH KXQGUHGWKV RI RIWKHDVVHWVLQHDFKPHPEHU¶VDFFRXQWDQQXDOO\7RWDOFRQWULEXWLRQVPDGHE\WKH&LW\GXULQJILVFDO\HDUZHUH 5HTXLUHG(PSOR\HH (PSOR\HU (PSOR\HH (PSOR\HU 5DWH &RQWULEXWLRQ$PRXQW3HUFHQWDJHRI&RYHUHG3D\UROO127( 08/7,(03/2<(5'(),1('%(1(),73(16,213/$1&LW\ HPSOR\HHV EHORQJLQJ WR ,QWHUQDWLRQDO 8QLRQ RI 2SHUDWLQJ (QJLQHHUV ,82( DUHSDUWLFLSDQWVLQDPXOWLHPSOR\HUGHILQHGEHQHILWSHQVLRQSODQ&HQWUDO3HQVLRQ)XQGRIWKH,QWHUQDWLRQDO8QLRQRI2SHUDWLQJ(QJLQHHUVDQG3DUWLFLSDWLQJ(PSOR\HUV &5) DGPLQLVWHUHGE\WKHERDUGRIWUXVWHHVRIWKH&HQWUDO3HQVLRQ)XQG7KHSODQLVDFRVWVKDULQJSHQVLRQSODQWKDWLVQRWDVWDWHRUORFDOJRYHUQPHQWDOSHQVLRQSODQLVXVHGWRSURYLGHGHILQHGEHQHILWSHQVLRQVERWKWRHPSOR\HUVWKDWDUHQRWVWDWHRUORFDOJRYHUQPHQWDOHPSOR\HUVDQGKDVQRSUHGRPLQDQW VWDWH RU ORFDO JRYHUQPHQW HPSOR\HU 7KH SODQ LVVXHV D SXEOLFO\ DYDLODEOHILQDQFLDOUHSRUWORFDWHGRQWKHLUZHEVLWHDWZZZFSILXRHRUJ7KH &LW\ KDV HPSOR\HHV ZKR DUH FRYHUHG E\ WKH SHQVLRQ SODQ7KH SODQ SURYLGHVEHQHILWV VXFK DV PRQWKO\ UHWLUHPHQW LQFRPH VSHFLDO DQG HDUO\ UHWLUHPHQW EHQHILWVSRVWUHWLUHPHQWVXUYLYLQJVSRXVHEHQHILWVDQGGLVDELOLW\EHQHILWV7KH&3)LVDVXSSOHPHQWDO3HQVLRQ)XQGDXWKRUL]HGE\0LQQHVRWD6WDWXWHVVXEGLYLVLRQ 7KH&3)3ODQRI%HQHILWVDQGWKH$JUHHPHQWDQG'HFODUDWLRQRI7UXVWZLOOVHUYHDVWKHJRYHUQLQJGRFXPHQWV7KH&LW\¶VFRQWULEXWLRQVWRWKHSODQDUHSXUVXDQWWRDFROOHFWLYHEDUJDLQLQJDJUHHPHQWZLWKWKH,82(ZKLFKH[SLUHG'HFHPEHU7KHUHTXLUHGFRQWULEXWLRQUDWHLVSHUKRXUZKLFKLVDSSOLHGWRDOOFRPSHQVDWHGKRXUVDQGFDSSHGDWSHU\HDU7RWDOHPSOR\HUFRQWULEXWLRQV IRU WKH \HDU HQGHG 'HFHPEHU ZHUH :LWKUHJDUGWRZLWKGUDZDOIURPWKHSHQVLRQSODQWKHSDUWLHVDJUHHWKDWWKHDPRXQWWKDWZRXOGRWKHUZLVHEHSDLG LQ VDODU\ RU ZDJHV ZLOO EH FRQWULEXWHG LQVWHDG WR WKH &3) DV SUHWD[ HPSOR\HUFRQWULEXWLRQV&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 27+(53267(03/2<0(17%(1(),76 23(% 3/$1$ 3ODQ'HVFULSWLRQ7KH &LW\ SURYLGHV SRVWHPSOR\PHQW LQVXUDQFH EHQHILWV WR FHUWDLQHOLJLEOH HPSOR\HHVWKURXJKLWV23(%3ODQDVLQJOHHPSOR\HUGHILQHGEHQHILWSODQDGPLQLVWHUHGE\WKH&LW\$OOSRVWHPSOR\PHQWEHQHILWVDUHEDVHGRQFRQWUDFWXDODJUHHPHQWVZLWKHPSOR\HHJURXSV(OLJLELOLW\ IRU WKHVH EHQHILWV LV EDVHG RQ \HDUV RI VHUYLFH DQGRU PLQLPXP DJHUHTXLUHPHQWV7KHVHFRQWUDFWXDODJUHHPHQWVGRQRWLQFOXGHDQ\VSHFLILFFRQWULEXWLRQRUIXQGLQJUHTXLUHPHQWV7KHSODQGRHVQRWLVVXHDSXEOLFO\DYDLODEOHILQDQFLDOUHSRUW1RSODQDVVHWV DUH DFFXPXODWHG LQ D WUXVW WKDW PHHWV WKH FULWHULD LQ SDUDJUDSK RI *$6%6WDWHPHQW1R% %HQHILWV3URYLGHG$OOUHWLUHHVRIWKH&LW\XSRQUHWLUHPHQWKDYHWKHRSWLRQXQGHUVWDWHODZWRFRQWLQXHWKHLUPHGLFDO LQVXUDQFH FRYHUDJH WKURXJK WKH &LW\ IURP WKH WLPH RI UHWLUHPHQW XQWLO WKHHPSOR\HH UHDFKHV WKH DJH RI HOLJLELOLW\ IRU 0HGLFDUH )RU PHPEHUV RI DOO HPSOR\HHJURXSVWKHUHWLUHH PXVW SD\ WKH IXOO SUHPLXP WR FRQWLQXH FRYHUDJH IRU PHGLFDO DQGGHQWDOLQVXUDQFH7KH&LW\LVOHJDOO\UHTXLUHGWRLQFOXGHDQ\UHWLUHHVIRUZKRPLWSURYLGHVKHDOWKLQVXUDQFHFRYHUDJHLQWKHVDPHLQVXUDQFHSRRODVLWVDFWLYHHPSOR\HHVZKHWKHUWKHSUHPLXPVDUHSDLG E\ WKH &LW\ RU WKH UHWLUHH &RQVHTXHQWO\ SDUWLFLSDWLQJ UHWLUHHV DUH FRQVLGHUHG WRUHFHLYHDVHFRQGDU\EHQHILWNQRZQDVDQ³LPSOLFLWUDWHVXEVLG\´7KLVEHQHILWUHODWHVWRWKHDVVXPSWLRQWKDWWKHUHWLUHHLVUHFHLYLQJDPRUHIDYRUDEOHSUHPLXPUDWHWKDQWKH\ZRXOGRWKHUZLVHEHDEOHWRREWDLQLISXUFKDVLQJLQVXUDQFHRQWKHLURZQGXHWREHLQJLQFOXGHGLQWKHVDPHSRROZLWKWKH&LW\¶V\RXQJHUDQGVWDWLVWLFDOO\KHDOWKLHUDFWLYHHPSOR\HHV)RUSROLFHRIILFHUVDQGILUHILJKWHUVGLVDEOHGLQWKHOLQHRIGXW\0LQQHVRWD6WDWXWHVUHTXLUHWKH&LW\WRFRQWLQXHSD\PHQWRIWKHHPSOR\HU¶VFRQWULEXWLRQWRZDUGKHDOWKFRYHUDJHIRUWKHSROLFHRIILFHURUILUHILJKWHUDQGWKHLUVSRXVHLIWKHVSRXVHZDVFRYHUHGDWWKHWLPHRIGLVDELOLW\XQWLODJH& &RQWULEXWLRQV7KHUHTXLUHGFRQWULEXWLRQLVEDVHGRQSURMHFWHGSD\DV\RXJRILQDQFLQJUHTXLUHPHQWVZLWKDGGLWLRQDODPRXQWVWRSUHIXQGEHQHILWVDVGHWHUPLQHGSHULRGLFDOO\E\WKH&LW\7KH&LW\¶V FXUUHQW \HDU UHTXLUHG SD\DV\RXJR FRQWULEXWLRQV WR ILQDQFH WKH EHQHILWVGHVFULEHGLQWKHSUHYLRXVVHFWLRQWRWDOHG7RWDO23(%OLDELOLW\ZLOOEHSDLGE\WKHJHQHUDOIXQGDQGHQWHUSULVHIXQGV' 0HPEHUVKLS0HPEHUVKLSLQWKHSODQFRQVLVWHGRIWKHIROORZLQJDVRIWKHODWHVWDFWXDULDOYDOXDWLRQ 5HWLUHHVDQG%HQHILFLDULHV5HFHLYLQJ%HQHILWV$FWLYH3ODQ0HPEHUV7RWDO0HPEHUVA-38 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 27+(53267(03/2<0(17%(1(),76 23(% 3/$1 &217,18(' ( 7RWDO23(%/LDELOLW\RIWKH&LW\7KH&LW\¶VWRWDO23(%OLDELOLW\ZDVGHWHUPLQHGE\DQDFWXDULDOYDOXDWLRQZLWKDYDOXDWLRQGDWHRI-DQXDU\/LDELOLWLHVLQWKLVUHSRUWZHUHUROOHGIRUZDUGWRWKHPHDVXUHPHQWGDWHRI'HFHPEHU) $FWXDULDO$VVXPSWLRQV7KHWRWDO23(%OLDELOLW\ZDVGHWHUPLQHGE\DQDFWXDULDOYDOXDWLRQDVRI-DQXDU\XVLQJ WKH IROORZLQJ DFWXDULDO DVVXPSWLRQV DSSOLHG WR DOO SHULRGV LQFOXGHG LQ WKHPHDVXUHPHQWXQOHVVRWKHUZLVHVSHFLILHG'LVFRXQW5DWH<HDU0XQLFLSDO%RQG<LHOG6DODU\,QFUHDVHV0HGLFDO7UHQG5DWHJUDGLQJWRE\7KHDFWXDULDODVVXPSWLRQVXVHGLQWKHODWHVWYDOXDWLRQZHUHEDVHGRQWKRVHXVHGWRYDOXH SHQVLRQOLDELOLWLHVIRU0LQQHVRWDFLW\HPSOR\HHV 7KHVWDWHSHQVLRQ SODQV EDVHWKHLUDVVXPSWLRQVRQSHULRGLFH[SHULHQFHVWXGLHV(FRQRPLFDVVXPSWLRQVDUHEDVHGRQLQSXWIURPDYDULHW\RISXEOLVKHGVRXUFHVRIKLVWRULFDODQGSURMHFWHGIXWXUHILQDQFLDOGDWD(DFKDVVXPSWLRQZDVUHYLHZHGIRUUHDVRQDEOHQHVVZLWKWKHVRXUFHLQIRUPDWLRQDVZHOODVIRUFRQVLVWHQF\ZLWKWKHRWKHUHFRQRPLFDVVXPSWLRQV6LQFHWKHSODQLVQRWIXQGHGE\DQLUUHYRFDEOHWUXVWWKHGLVFRXQWUDWHLVHTXDOWRWKH\HDUPXQLFLSDOERQG\LHOGUDWHRIZKLFKZDVVHWE\FRQVLGHULQJSXEOLVKHGUDWHLQIRUPDWLRQIRU\HDUKLJKTXDOLW\WD[H[HPSWJHQHUDOREOLJDWLRQPXQLFLSDOERQGVDVRIWKHPHDVXUHPHQWGDWH7KH&LW\GLVFRXQWUDWHXVHGLQWKHSULRUPHDVXUHPHQWGDWHZDV 0RUWDOLW\UDWHVZHUHEDVHGRQWKH53PRUWDOLW\WDEOHVDGMXVWHGIRUZKLWHFROODUDQGPRUWDOLW\LPSURYHPHQWVXVLQJSURMHFWLRQVFDOH03IURPDEDVH\HDURIIRU*(5)PHPEHUVDQG03IURPDEDVH\HDURIIRU3(3))PHPEHUV)XWXUHUHWLUHHVHOHFWLQJFRYHUDJHLVDVVXPHGWR0DUULHGIXWXUHUHWLUHHVHOHFWLQJVSRXVH FRYHUDJH LV DVVXPHG WR UDQJH IURP WR EDVHG RQ FODVVLILFDWLRQ RIHPSOR\HH&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 27+(53267(03/2<0(17%(1(),76 23(% 3/$1 &217,18(' * &KDQJHVLQWKH7RWDO23(%/LDELOLW\7RWDO23(%/LDELOLW\%HJLQQLQJ%DODQFH&KDQJHVIRUWKH<HDU 6HUYLFH&RVW ,QWHUHVW'LIIHUHQFHEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFH &KDQJHVRI$VVXPSWLRQV%HQHILW3D\PHQWV 7RWDO1HW&KDQJHV (QGLQJ%DODQFH$VVXPSWLRQFKDQJHVVLQFHWKHSULRUPHDVXUHPHQWGDWHLQFOXGHWKHIROORZLQJ x 7KHGLVFRXQWUDWHZDVFKDQJHGIURP WRx 7KHSD\UROOJURZWKUDWHFKDQJHGIURPWR+ 7RWDO23(%/LDELOLW\6HQVLWLYLW\WR'LVFRXQWDQG+HDOWK&DUH&RVW7UHQG5DWH&KDQJHV7KHIROORZLQJSUHVHQWVWKHWRWDO23(%OLDELOLW\RIWKH&LW\DVZHOODVZKDWWKH&LW\¶VWRWDO23(%OLDELOLW\ZRXOGEHLILWZHUHFDOFXODWHGXVLQJDGLVFRXQWUDWHWKDWLVSHUFHQWDJHSRLQWORZHURUSHUFHQWDJHSRLQWKLJKHUWKDQWKHFXUUHQWGLVFRXQWUDWH 'HFUHDVHLQ,QFUHDVHLQ'LVFRXQW5DWH 'LVFRXQW5DWH 'LVFRXQW5DWH23(%'LVFRXQW5DWH 7RWDO23(%/LDELOLW\7KHIROORZLQJSUHVHQWVWKHWRWDO23(%OLDELOLW\RIWKH&LW\DVZHOODVZKDWWKH&LW\¶VWRWDO23(%OLDELOLW\ZRXOGEHLILWZHUHFDOFXODWHGXVLQJKHDOWKFDUHFRVWWUHQGUDWHVWKDWDUHSHUFHQWDJHSRLQWORZHURUSHUFHQWDJHSRLQWKLJKHUWKDQWKHFXUUHQWKHDOWKFDUHFRVWWUHQGUDWHV 'HFUHDVHLQ,QFUHDVHLQ0HGLFDO7UHQG 0HGLFDO7UHQG0HGLFDO7UHQG5DWH5DWH5DWH23(%0HGLFDO7UHQG5DWHGHFUHDVLQJWRRYHU\HDUVGHFUHDVLQJWRRYHU\HDUVGHFUHDVLQJWRRYHU\HDUV7RWDO23(%/LDELOLW\ A-39 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 27+(53267(03/2<0(17%(1(),76 23(% 3/$1 &217,18(' , 23(%([SHQVHDQG5HODWHG'HIHUUHG2XWIORZVRI5HVRXUFHVDQG'HIHUUHG,QIORZVRI5HVRXUFHV)RUWKHFXUUHQW\HDUHQGHGWKH&LW\UHFRJQL]HG23(%H[SHQVHRI $VRI\HDUHQGWKH&LW\UHSRUWHGGHIHUUHGRXWIORZVRIUHVRXUFHVDQGGHIHUUHGLQIORZVRIUHVRXUFHVUHODWHGWR23(%IURPWKHIROORZLQJVRXUFHV 'HIHUUHG'HIHUUHG2XWIORZV,QIORZVRI5HVRXUFHVRI5HVRXUFHV'LIIHUHQFHEHWZHHQH[SHFWHGDQGDFWXDOH[SHULHQFH&KDQJHVRI$VVXPSWLRQV&LW\&RQWULEXWLRQV6XEVHTXHQWWRWKH0HDVXUHPHQW'DWH7RWDO $WRWDORIUHSRUWHGDVGHIHUUHGRXWIORZVRIUHVRXUFHVUHODWHGWR23(%UHVXOWLQJIURP FLW\FRQWULEXWLRQV VXEVHTXHQWWRWKH PHDVXUHPHQW GDWHZLOOEHUHFRJQL]HGDVDUHGXFWLRQ RI WKH WRWDO 23(% OLDELOLW\ LQ WKH \HDU HQGLQJ 'HFHPEHU 2WKHUDPRXQWVUHSRUWHGDVGHIHUUHGRXWIORZVDQGLQIORZVRIUHVRXUFHVUHODWHGWRWKHSODQZLOOEHUHFRJQL]HGLQSHQVLRQH[SHQVHDVIROORZV 23(%([SHQVH<HDU(QGHG'HFHPEHU$PRXQW 7KHUHDIWHU &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5(69) 127( 5(&(,9$%/(63$<$%/(6$1'75$16)(56Housing andInternalRedevelopment Debt Aquatic Nonmajor ServiceGeneral Authority Service Construction Liquor Center Golf Course Arena Enterprise Funds TotalTransfer Out: General Fund: -$ 300,000$ -$ 4,203,106$ -$ -$ -$ -$ -$ -$ 4,503,106$ Construction Fund 112,211 - 2,955,444 - - - - - - - 3,067,655 Nonmajor Governmental68,895 - - - - - - - - - 68,895 Utilities Fund211,500 - - 357,200 4,156 17,269 53,364 40,605 62,477 3,760 750,331 Liquor Fund50,000 - - 150,000 - - - 300,000 350,000 850,000 Total442,606$ 300,000$ 2,955,444$ 4,710,306$ 4,156$ 17,269$53,364$ 340,605$ 412,477$ 3,760$ 9,239,987$ Transfers InInterfund transfers allow the City to allocate financial resources to the funds that receive benefit from services provided by another fund. Some of the City’s interfund transfers fall under that category. Nonroutine transfers include the following: 1. The liquor fund transferred $300,000, $250,000, $100,000, and $50,000 to the arena fund, art center fund, Centennial Lakes fund, and general fund, respectively. 2. The utilities fund and liquor fund transferred $357,200 and $150,000 to the construction fund to fund the capital improvement program, as planned in the 2021 budget. 3. The construction fund transferred $2,955,444 of PIR assessment revenue to the debt service fund for related debt payments. 4. The general fund transferred $300,000 and $4,203,106 to the HRA fund (rental assistance) and construction fund (capital funding). 5. The utilities fund transferred a total of $393,131 to the general fund, other enterprise funds, and internal service funds to offset the cost of internal utilities. 6. Nonmajor governmental funds and the construction fund transferred $68,895 to close the arts & culture fund and $112,211 to assist with various costs. 127( 7$;,1&5(0(17',675,&76The Housing Redevelopment Authority and City of Edina are the administering authorities for the following Tax Increment Districts: District number 1211 (Pentagon Park Increment Financing District) is an economic development district established in 2014 pursuant to Minnesota Statutes with a termination date of 2043. District number 1212 (Grandview 2 Increment Financing District) is an economic development district established in 2016 pursuant to Minnesota Statutes with a termination date of 2045. District number 1214 (66 West Increment Financing District) is an economic development district established in 2016 pursuant to Minnesota Statutes with a termination date of 2045. A-40 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 7$;,1&5(0(17',675,&76 &217,18(' 'LVWULFWQXPEHU WKDQG)UDQFH LVDQHFRQRPLFGHYHORSPHQWGLVWULFWHVWDEOLVKHGLQSXUVXDQWWR0LQQHVRWD6WDWXWHVZLWKDWHUPLQDWLRQGDWHRI'LVWULFWQXPEHU WKDQG)UDQFH LVDUHQHZDODQGUHQRYDWLRQGHYHORSPHQWGLVWULFWHVWDEOLVKHGLQ SXUVXDQWWR0LQQHVRWD6WDWXWHVZLWKDWHUPLQDWLRQGDWHRI'LVWULFWQXPEHU :HVWWK6WUHHW LVDKRXVLQJGLVWULFWHVWDEOLVKHGLQ SXUVXDQWWR0LQQHVRWD6WDWXWHVZLWKDWHUPLQDWLRQGDWHRI'LVWULFWQXPEHU QGDQG)UDQFH LVDKRXVLQJGLVWULFWHVWDEOLVKHGLQ SXUVXDQWWR0LQQHVRWD6WDWXWHVZLWKDWHUPLQDWLRQGDWHRI'LVWULFWQXPEHU $PXQGVRQ$YH LVDQDIIRUGDEOHKRXVLQJGLVWULFWHVWDEOLVKHGLQ SXUVXDQWWR0LQQHVRWD6WDWXWHVZLWKDWHUPLQDWLRQGDWHRI7KHIROORZLQJWDEOHUHIOHFWVYDOXHVDVRI'HFHPEHU 7,) 7,) 7,) 7,) 7,) 7,) 7,)7,) 7RWDO2ULJLQDO7D[&DSDFLW\ &XUUHQW7D[&DSDFLW\ )LVFDO'LVSDULWLHV 7D[&DSDFLW\&KDQJH 5HWDLQHG&DSWXUHG7D[&DSDFLW\ 127( &217,1*(1&,(6$ 5LVN0DQDJHPHQW7KH&LW\LVH[SRVHGWRYDULRXVULVNVRIORVVUHODWHGWRWRUWVWKHIWRIGDPDJHWRDQGGHVWUXFWLRQRIDVVHWV HUURUVDQGRPLVVLRQV LQMXULHVWRHPSOR\HHV DQGQDWXUDOGLVDVWHUV:RUNHUV¶FRPSHQVDWLRQLQVXUDQFHZDVSURYLGHGWKURXJKWKH/HDJXHRI0LQQHVRWD&LWLHV,QVXUDQFH 7UXVW 7KHUH LV D GHGXFWLEOH SHU RFFXUUHQFH DQG LQDJJUHJDWH7KH&LW\KDVDQDQQXDOGHSRVLWSUHPLXPWKDWLVVXEMHFWWRDGMXVWPHQWEDVHGRQWKHDFWXDODXGLWHGSD\UROO$ SDFNDJH SROLF\ LQFOXGLQJ SURSHUW\ JHQHUDO OLDELOLW\ DQG DXWRPRELOH FRYHUDJH LVSURYLGHGWKURXJKWKH/HDJXHRI0LQQHVRWD&LWLHV,QVXUDQFH7UXVW8QGHUWKLVSROLF\WKH&LW\ SD\V DQ DQQXDO SUHPLXP DQG KDG D SHU RFFXUUHQFH GHGXFWLEOH DQG LVVXEMHFW WR DQ DQQXDO DJJUHJDWH GHGXFWLEOH RI ZLWK D SHURFFXUUHQFHPD[LPXP/LTXRUOLDELOLW\FRYHUDJHLVSURYLGHGWKURXJKWKH/HDJXHRI0LQQHVRWD&LWLHV,QVXUDQFH7UXVW7KH&LW\SD\VDQDQQXDOSUHPLXPIRUWKLVFRYHUDJHDQGKDVDDQQXDOPD[LPXP6HWWOHPHQWFODLPVKDYHQRWH[FHHGHGLQVXUDQFHFRYHUDJHIRUHDFKRIWKHSDVWWKUHH\HDUV7KHUHZHUHQRVLJQLILFDQWGHFUHDVHVLQLQVXUDQFHFRYHUDJHGXULQJ&,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( &217,1*(1&,(6 &217,18(' % /LWLJDWLRQ7KH&LW\DWWRUQH\KDVLQGLFDWHGWKDW H[LVWLQJ DQG SHQGLQJ ODZVXLWV FODLPV DQGRWKHUDFWLRQVLQZKLFKWKH&LW\LVDGHIHQGDQWDUHHLWKHUFRYHUHGE\LQVXUDQFH RIDQLPPDWHULDODPRXQW RULQWKHMXGJPHQWRIWKH&LW\DWWRUQH\UHPRWHO\UHFRYHUDEOHE\SODLQWLIIV& )HGHUDODQG6WDWH)XQGV7KH&LW\UHFHLYHVILQDQFLDODVVLVWDQFHIURPIHGHUDODQGVWDWHJRYHUQPHQWDODJHQFLHVLQWKHIRUPRIJUDQWV7KHGLVEXUVHPHQWRIIXQGVUHFHLYHGXQGHUWKHVHSURJUDPVJHQHUDOO\UHTXLUHVFRPSOLDQFHZLWKWKHWHUPVDQGFRQGLWLRQVVSHFLILHGLQWKHJUDQWDJUHHPHQWVDQGLVVXEMHFWWRDXGLWE\WKHJUDQWRUDJHQFLHV$Q\GLVDOORZHGFODLPVUHVXOWLQJIURPVXFKDXGLWV FRXOG EHFRPH D OLDELOLW\ RI WKH DSSOLFDEOH IXQG +RZHYHU LQ WKH RSLQLRQ RIPDQDJHPHQWDQ\VXFKGLVDOORZHGFODLPVZLOOQRWKDYHDPDWHULDOHIIHFWRQDQ\RIWKHILQDQFLDO VWDWHPHQWV RI WKH LQGLYLGXDO IXQG W\SHV LQFOXGHG KHUHLQ RU RQ WKH RYHUDOOILQDQFLDOSRVLWLRQRIWKH&LW\DW'HFHPEHU' 7D[,QFUHPHQW'LVWULFWV7KH&LW\¶VWD[LQFUHPHQWGLVWULFWVDUHVXEMHFWWRUHYLHZE\WKHVWDWHRI0LQQHVRWD2IILFHRIWKH6WDWH$XGLWRU 26$ $Q\GLVDOORZHGFODLPVRUPLVXVHRIWD[LQFUHPHQWVFRXOGEHFRPHDOLDELOLW\RIWKHDSSOLFDEOHIXQG0DQDJHPHQWLVQRWDZDUHRIDQ\LQVWDQFHVRIQRQFRPSOLDQFHZKLFKZRXOGKDYHDPDWHULDOHIIHFWRQWKHILQDQFLDOVWDWHPHQWV127( &21'8,7'(%72%/,*$7,21$VRI'HFHPEHUWKH&LW\RI(GLQDKDGIRXUVHULHVRI+RXVLQJDQG+HDOWK&DUH5HYHQXH%RQGVZLWKDQDJJUHJDWHSULQFLSDODPRXQWSD\DEOHRI7KHERQGVDUHSD\DEOHVROHO\IURPUHYHQXHVRIWKHUHVSHFWLYHRUJDQL]DWLRQVDQGGRQRWFRQVWLWXWHDQLQGHEWHGQHVVRIWKH&LW\DQGDUHQRWDFKDUJHDJDLQVWLWVJHQHUDOFUHGLWRUWD[LQJSRZHU$FFRUGLQJO\ WKH ERQGV DUH QRW UHSRUWHG DV OLDELOLWLHV LQ WKH DFFRPSDQ\LQJ ILQDQFLDOVWDWHPHQWV127( -2,179(1785(7KH &LW\ LV D SDUWLFLSDQW ZLWK WKH &LW\ RI %ORRPLQJWRQWKH &LW\ RI (GHQ 3UDLULH DQG WKH0HWURSROLWDQ$LUSRUW&RPPLVVLRQLQDMRLQWYHQWXUHWRFRQVWUXFWDQGRSHUDWHDIDFLOLW\WREHXVHGIRUWKHWUDLQLQJRIODZHQIRUFHPHQWRIILFHUVDQGILUHILJKWHUV7KH6RXWK0HWUR3XEOLF6DIHW\ 7UDLQLQJ )DFLOLW\ $VVRFLDWLRQ 367) LV JRYHUQHG E\ D ERDUG FRQVLVWLQJ RI RQHUHSUHVHQWDWLYHIURPHDFK0HPEHU2QGLVVROXWLRQRIWKH$VVRFLDWLRQWKH)DFLOLW\VKDOOUHYHUWWRWKH&LW\RI(GLQDDQGDOOUHPDLQLQJDVVHWVVKDOOEHGLYLGHGDPRQJWKHPHPEHUVEDVHGRQWKH&RVW6KDULQJ)RUPXOD,QDFFRUGDQFHZLWKWKHMRLQWYHQWXUHDJUHHPHQWHDFKPHPEHURIWKHDVVRFLDWLRQZLOOVKDUHLQWKHFRVWRIWKHFRQVWUXFWLRQDQGRSHUDWLRQEDVHGRQWKH&RVW6KDULQJ )RUPXOD 7KH &LW\¶V HTXLW\LQWHUHVWLQWKHFDSLWDODVVHWV RI WKH 367) ZDV&RPSOHWHILQDQFLDOVWDWHPHQWVIRU367)FDQEHREWDLQHGIURPWKH&LW\RI(GLQD:HVWWK6WUHHW(GLQD0LQQHVRWDA-41 &,7<2)(',1$0,11(627$127(672),1$1&,$/67$7(0(176'(&(0%(5 127( 5(/$7('3$57<75$16$&7,2167KH&LW\SD\VDQDQQXDOPHPEHUVKLSIHHWRWKH6RXWK0HWUR3XEOLF6DIHW\7UDLQLQJ)DFLOLW\DVSDUWRIWKHMRLQWYHQWXUHDJUHHPHQW7KHPHPEHUVKLSIHHLVSDLGE\WKH3ROLFHDQG)LUHGHSDUWPHQWVDQGLVEDVHGRQD&RVW6KDULQJ)RUPXOD)RUWKH\HDUHQGHG'HFHPEHUWKH&LW\SDLGDWRWDORILQPHPEHUVKLSIHHVWRWKH367)HTXDOWR RIPHPEHUVKLSIHHVFROOHFWHGIRUWKH\HDU127( )81'%$/$1&(6$ &ODVVLILFDWLRQV$W 'HFHPEHU D VXPPDU\ RI WKH &LW\¶V JRYHUQPHQWDO IXQG EDODQFHFODVVLILFDWLRQVDUHDVIROORZV *HQHUDO+5$ 'HEW6HUYLFH &RQVWUXFWLRQ 1RQPDMRU)XQG)XQG)XQG)XQG)XQGV7RWDO1RQVSHQGDEOH 5HVWULFWHG 3DUN'HGLFDWLRQ7D[,QFUHPHQWV $IIRUGDEOH+RXVLQJ 'HEW6HUYLFH 3HGHVWULDQDQG&\FOLVW,PSURYHPHQWV )RUIHLWXUHV 'RQDWLRQV &RQVHUYDWLRQDQG6XVWDLQDELOLW\,QLWLDWLYHV 7RWDO5HVWULFWHG $VVLJQHG&RPSHQVDWHG$EVHQFHV %XGJHW6WDELOL]DWLRQ %XLOGLQJ6HFXULW\3XEOLF+HDOWK*UDQW 6SHFLDO3URMHFWV (TXLSPHQW 3,5 &RQVWUXFWLRQ 7RWDO$VVLJQHG 8QDVVLJQHG 7RWDO)XQG%DODQFH % 8QDVVLJQHG)XQG%DODQFH3ROLF\7KH&LW\&RXQFLOKDVIRUPDOO\DGRSWHGDIXQGEDODQFHSROLF\UHJDUGLQJWKHGHVLUHGUDQJHIRU XQDVVLJQHG IXQG EDODQFH IRUWKH JHQHUDO IXQG 7KH SROLF\ HVWDEOLVKHV D JRDO IRUXQDVVLJQHGJHQHUDOIXQGEDODQFH RI ± RIWKH VXEVHTXHQW\HDU¶V EXGJHWHGSURSHUW\WD[UHYHQXH$VRI'HFHPEHUWKH&LW\KDV RIXQDVVLJQHGIXQGEDODQFHLQWKHJHQHUDOIXQGRURIEXGJHWHGSURSHUW\WD[UHYHQXH7KLVDPRXQWLVDERYHWKHPLQLPXPJRDOLGHQWLILHGLQWKHSROLF\& 'HILFLW)XQG(TXLW\7KHIROORZLQJIXQGVKDGDGHILFLWIXQGEDODQFHQHWSRVLWLRQDW'HFHPEHU 1RQPDMRU3URSULHWDU\)XQGV $UW&HQWHU &,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21%8'*(7$5<&203$5,6216&+('8/(±*(1(5$/)81'<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ $FWXDO9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDO%XGJHW5(9(18(67D[HV *HQHUDO3URSHUW\7D[HV )UDQFKLVH7D[HV /RGJLQJ7D[ 7RWDO7D[HV /LFHQVHVDQG3HUPLWV ,QWHUJRYHUQPHQWDO )HGHUDO 6WDWH 0XQLFLSDO6WDWH$LG 2WKHU 6WDWH$LG3ROLFH 6WDWH$LG)LUH +HDOWK3URJUDPV 7RWDO,QWHUJRYHUQPHQWDO &KDUJHVIRU6HUYLFHV $GPLQLVWUDWLRQ &RPPXQLFDWLRQVDQG7HFKQRORJ\ )LQDQFH (QJLQHHULQJ 3ROLFH )LUH 3DUNVDQG5HFUHDWLRQ &RPPXQLW\'HYHORSPHQW 7RWDO&KDUJHVIRU6HUYLFHV )LQHVDQG)RUIHLWV 0LVFHOODQHRXV ,QYHVWPHQW,QFRPH 5HQWDORI3URSHUW\ 2WKHU 7RWDO0LVFHOODQHRXV 7RWDO5HYHQXHV %XGJHWHG$PRXQWVA-42 &,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21%8'*(7$5<&203$5,6216&+('8/(±*(1(5$/)81' &217,18(' <($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ $FWXDO9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDO%XGJHW(;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW $GPLQLVWUDWLRQ 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO$GPLQLVWUDWLRQ &RPPXQLFDWLRQV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO&RPPXQLFDWLRQV +XPDQ5HVRXUFHV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO+XPDQ5HVRXUFHV )LQDQFH 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO)LQDQFH &RPPXQLW\'HYHORSPHQW 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO&RPPXQLW\'HYHORSPHQW 7RWDO*HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3ROLFH 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV,QWHUQDO6HUYLFHV 7RWDO3ROLFH )LUH 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO)LUH%XGJHWHG$PRXQWV&,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21%8'*(7$5<&203$5,6216&+('8/(±*(1(5$/)81' &217,18(' <($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ $FWXDO 9DULDQFHZLWK2ULJLQDO )LQDO $PRXQWV )LQDO%XGJHW%XGJHWHG$PRXQWV(;3(1',785(6 &217,18(' &XUUHQW &RQWLQXHG 3XEOLF6DIHW\ &RQWLQXHG 3XEOLF+HDOWK 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO3XEOLF+HDOWK 7RWDO3XEOLF6DIHW\ 3XEOLF:RUNV 3XEOLF:RUNV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO3XEOLF:RUNV (QJLQHHULQJ 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 7RWDO(QJLQHHULQJ 7RWDO3XEOLF:RUNV 3DUNV 3DUNVDQG5HFUHDWLRQ 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV&RPPRGLWLHV ,QWHUQDO6HUYLFHV7RWDO3DUNVDQG5HFUHDWLRQ 7RWDO3DUNV &DSLWDO2XWOD\ 3DUNV7RWDO([SHQGLWXUHV A-43 &,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21%8'*(7$5<&203$5,6216&+('8/(±*(1(5$/)81' &217,18(' <($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ $FWXDO 9DULDQFHZLWK2ULJLQDO )LQDO $PRXQWV )LQDO%XGJHW%XGJHWHG$PRXQWV5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV,Q 7UDQVIHUV2XW 7RWDO)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\)81'%$/$1&('(&(0%(5&,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21%8'*(7$5<&203$5,6216&+('8/(+286,1*$1'5('(9(/230(17$87+25,7< +5$ )81'<($5(1'(''(&(0%(56HHDFFRPSDQ\LQJ1RWHVWR5HTXLUHG6XSSOHPHQWDU\,QIRUPDWLRQ $FWXDO9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDO%XGJHW5(9(18(6*HQHUDO3URSHUW\7D[HV 7D[LQFUHPHQW&ROOHFWLRQV ,QYHVWPHQW,QFRPH &KDUJHVIRU6HUYLFHV 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV &DSLWDO2XWOD\ 'HEW6HUYLFH ,QWHUHVWDQG)LVFDO&KDUJHV 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV,Q%RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\)81'%$/$1&('(&(0%(5 %XGJHWHG$PRXQWVA-44 &,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,2127+(53267(03/2<0(17%(1(),763/$16&+('8/(2)&+$1*(6,17+(&,7<¶6727$/23(%/,$%,/,7<$1'5(/$7('5$7,26<($5(1'(''(&(0%(51RWHV 7KH&LW\LPSOHPHQWHG*$6%6WDWHPHQW1RLQILVFDO7KLVVFKHGXOHLVLQWHQGHGWRSUHVHQW\HDUWUHQGLQIRUPDWLRQ$GGLWLRQDO\HDUVZLOOEHDGGHGDVWKH\EHFRPHDYDLODEOH1RSODQDVVHWVDUHDFFXPXODWHGLQDWUXVWWKDWPHHWVWKHFULWHULDLQSDUDJUDSKRI*$6%6WDWHPHQW1R 'HFHPEHU 'HFHPEHU 'HFHPEHU 'HFHPEHU 7RWDO23(%/LDELOLW\ 6HUYLFH&RVW ,QWHUHVW 'LIIHUHQFH%HWZHHQ([SHFWHGDQG$FWXDO([SHULHQFH &KDQJHVRI$VVXPSWLRQV %HQHILW3D\PHQWV 1HW&KDQJHVLQ7RWDO23(%/LDELOLW\ 7RWDO23(%/LDELOLW\%HJLQQLQJRI<HDU 7RWDO23(%/LDELOLW\(QGRI<HDU &RYHUHG(PSOR\HH3D\UROO 7RWDO23(%/LDELOLW\DVD3HUFHQWDJHRI&RYHUHG(PSOR\HH3D\UROO 0HDVXUHPHQW'DWH&,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,21*(5)6&+('8/(2)&,7<¶6$1'121(03/2<(53523257,21$7(6+$5(2)1(73(16,21/,$%,/,7<$1'6&+('8/(2)&,7<&2175,%87,216<($5(1'(''(&(0%(51RWH 7KH&LW\LPSOHPHQWHG*$6%6WDWHPHQW1RLQILVFDO XVLQJD-XQHPHDVXUHPHQWGDWH 7KLVVFKHGXOHLVLQWHQGHGWRSUHVHQW\HDUWUHQGLQIRUPDWLRQ$GGLWLRQDO\HDUVZLOOEHDGGHGDVWKH\EHFRPHDYDLODEOH &LW\ V3URSRUWLRQDWH6KDUHRIWKH1HW6WDWH V 3HQVLRQ/LDELOLW\&LW\ V3ODQ3URSRUWLRQDWH DQGWKH6WDWH V 3URSRUWLRQDWH )LGXFLDU\1HW&LW\ V&LW\ V 6KDUHRIWKH 3URSRUWLRQDWH6KDUHRIWKH 3RVLWLRQDVD3(5$)LVFDO 3URSRUWLRQ 3URSRUWLRQDWH 1HW3HQVLRQ 6KDUHRIWKH1HW 1HW3HQVLRQ 3HUFHQWDJH&LW\)LVFDO <HDU(QG'DWH RIWKH1HW 6KDUHRIWKH /LDELOLW\ 3HQVLRQ/LDELOLW\ &LW\ V /LDELOLW\DVD RIWKH7RWDO<HDU(QG 0HDVXUHPHQW 3HQVLRQ 1HW3HQVLRQ $VVRFLDWHG $VVRFLDWHGZLWK&RYHUHG 3HUFHQWDJHRI 3HQVLRQ'DWH'DWH /LDELOLW\ /LDELOLW\ ZLWKWKH&LW\WKH&LW\3D\UROO &RYHUHG3D\UROO /LDELOLW\ &RQWULEXWLRQVLQ5HODWLRQWR&LW\)LVFDO 6WDWXWRULO\ WKH6WDWXWRULO\ &RQWULEXWLRQ&RQWULEXWLRQVDVD<HDU(QG 5HTXLUHG 5HTXLUHG 'HILFLHQF\ &RYHUHG 3HUFHQWDJHRI'DWH &RQWULEXWLRQV &RQWULEXWLRQV ([FHVV 3D\UROO &RYHUHG3D\UROO 6FKHGXOHRI&LW\ VDQG1RQHPSOR\HU3URSRUWLRQDWH6KDUHRI1HW3HQVLRQ/LDELOLW\6FKHGXOHRI&LW\&RQWULEXWLRQVA-45 &,7<2)(',1$0,11(627$5(48,5('6833/(0(17$5<,1)250$7,213(3))6&+('8/(2)&,7<¶63523257,217(6+$5(2)1(73(16,21/,$%,/,7<$1'6+('8/(2)&,7<&2175,%87,216<($5(1'(''(&(0%(51RWH 7KH&LW\LPSOHPHQWHG*$6%6WDWHPHQW1RLQILVFDO XVLQJD-XQHPHDVXUHPHQWGDWH 7KLVVFKHGXOHLVLQWHQGHGWRSUHVHQW\HDUWUHQGLQIRUPDWLRQ$GGLWLRQDO\HDUVZLOOEHDGGHGDVWKH\EHFRPHDYDLODEOH &LW\ V3URSRUWLRQDWH6KDUHRIWKH1HW6WDWH V 3HQVLRQ/LDELOLW\&LW\ V3ODQ3URSRUWLRQDWH DQGWKH6WDWH V3URSRUWLRQDWH )LGXFLDU\1HW&LW\ V&LW\ V 6KDUHRIWKH 3URSRUWLRQDWH6KDUHRIWKH 3RVLWLRQDVD3(5$)LVFDO 3URSRUWLRQ3URSRUWLRQDWH 1HW3HQVLRQ 6KDUHRIWKH1HW 1HW3HQVLRQ 3HUFHQWDJH&LW\)LVFDO <HDU(QG'DWH RIWKH1HW6KDUHRIWKH /LDELOLW\ 3HQVLRQ/LDELOLW\ &LW\ V /LDELOLW\DVD RIWKH7RWDO<HDU(QG 0HDVXUHPHQW 3HQVLRQ1HW3HQVLRQ $VVRFLDWHG$VVRFLDWHGZLWK &RYHUHG 3HUFHQWDJHRI 3HQVLRQ'DWH'DWH /LDELOLW\/LDELOLW\ ZLWKWKH&LW\ WKH&LW\3D\UROO &RYHUHG3D\UROO /LDELOLW\ &RQWULEXWLRQVLQ5HODWLRQWR&LW\)LVFDO 6WDWXWRULO\ WKH6WDWXWRULO\ &RQWULEXWLRQ&RQWULEXWLRQVDVD<HDU(QG 5HTXLUHG 5HTXLUHG 'HILFLHQF\ &RYHUHG 3HUFHQWDJHRI'DWH &RQWULEXWLRQV &RQWULEXWLRQV ([FHVV 3D\UROO &RYHUHG3D\UROO 6FKHGXOHRI&LW\ V3URSRUWLRQDWH6KDUHRI1HW3HQVLRQ/LDELOLW\6FKHGXOHRI&LW\&RQWULEXWLRQV&,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( /(*$/&203/,$1&(±%8'*(767KH &LW\ IROORZV WKHVH SURFHGXUHV LQ HVWDEOLVKLQJ WKH EXGJHWDU\ GDWD UHIOHFWHG LQ WKHSUHFHGLQJVFKHGXOHV 7KH&LW\0DQDJHUVXEPLWVWRWKH&LW\&RXQFLODSURSRVHGRSHUDWLQJEXGJHWIRUWKHILVFDO \HDU FRPPHQFLQJ WKH IROORZLQJ -DQXDU\ 7KH RSHUDWLQJ EXGJHW LQFOXGHVSURSRVHGH[SHQGLWXUHVDQGWKHPHDQVRIILQDQFLQJWKHP 3XEOLFKHDULQJVDUHFRQGXFWHGWRREWDLQWD[SD\HUFRPPHQWV 7KHEXGJHWLVOHJDOO\HQDFWHGE\WKHSDVVDJHRIDUHVROXWLRQE\WKH&LW\&RXQFLO )RUPDOEXGJHWDU\LQWHJUDWLRQLVHPSOR\HGDVDPDQDJHPHQWFRQWUROGHYLFHGXULQJWKH\HDU %XGJHWV IRU DOO JRYHUQPHQWDO IXQGV DUH DGRSWHG RQ D EDVLV FRQVLVWHQW ZLWKDFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD 5HSRUWHG EXGJHW DPRXQWV DUH DV RULJLQDOO\ DGRSWHG RU DV DPHQGHG E\ &RXQFLODSSURYHGVXSSOHPHQWDODSSURSULDWLRQVDQGEXGJHWWUDQVIHUV ([SHQGLWXUHVPD\QRWOHJDOO\H[FHHGDSSURSULDWLRQVE\GHSDUWPHQWLQWKH*HQHUDO)XQGXQOHVVRIIVHWE\LQFUHDVHVLQUHYHQXHV$OOXQHQFXPEHUHGDSSURSULDWLRQVODSVHDW\HDUHQG127( (;&(662)(;3(1',785(629(5$335235,$7,2167KH *HQHUDO )XQG LV OHJDOO\ DGRSWHG RQ D EDVLV FRQVLVWHQW ZLWKDFFRXQWLQJ SULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD7KHOHJDOOHYHORIEXGJHWDU\FRQWUROLVDWWKH GHSDUWPHQW OHYHO IRU WKH *HQHUDO )XQG 7KH IROORZLQJ LV D OLVWLQJ RI *HQHUDO )XQGGHSDUWPHQWVZKRVHH[SHQGLWXUHVH[FHHGEXGJHWDSSURSULDWLRQV)LQDO2YHU%XGJHW$FWXDO%XGJHW*HQHUDO)XQG *HQHUDO*RYHUQPHQW $GPLQLVWUDWLRQ +XPDQ5HVRXUFHV )LQDQFH3XEOLF6DIHW\ 3ROLFH )LUH3XEOLF:RUNV (QJLQHHULQJ &DSLWDO2XWOD\([FHVVH[SHQGLWXUHVLQWKH+XPDQ5HVRXUFHVDUHGXHWRVHYHUDQFHLQWKHFXUUHQW\HDU6HYHUDQFHYDULHVIURP\HDUWR\HDU([FHVVH[SHQGLWXUHVLQ)LQDQFHDUHGXHWR$PHULFDQ5HVFXH3ODQ$FW $53$ H[SHQGLWXUHVLQFXUUHGLQ([FHVVH[SHQGLWXUHVLQ)LUHDUHUHODWHGWRVHYHUDQFHEHQHILWVDVVRFLDWHGZLWKWKHGLVVROXWLRQRIWKH)LUH5HOLHI$VVRFLDWLRQA-46 &,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( (;&(662)(;3(1',785(629(5$335235,$7,216 &217,18(' ([FHVV H[SHQGLWXUHV LQ (QJLQHHULQJ DUH GXH WR FKDQJHV LQ WKH RUJDQL]DWLRQDO VWUXFWXUH)DFLOLWLHVPDQDJHPHQWZDVPRYHGIURP3XEOLF:RUNVWR(QJLQHHULQJIRUDFWXDOEXWEXGJHWVZHUH QRW DGMXVWHG UHVXOWLQJ LQ XQIDYRXUDELOLW\ LQ (QJLQHHULQJDQG IDYRUDELOLW\ LQ 3XEOLF:RUNV5HPDLQLQJH[FHVVH[SHQGLWXUHVZHUHGXHWRVOLJKWO\KLJKHUWKDQDQWLFLSDWHGFRVWV7KHUHPDLQLQJJRYHUQPHQWDOIXQGVEXGJHWVDUHOHJDOO\DGRSWHGRQDEDVLVFRQVLVWHQWZLWKDFFRXQWLQJSULQFLSOHVJHQHUDOO\DFFHSWHGLQWKH8QLWHG6WDWHVRI$PHULFD7KHOHJDOOHYHORIEXGJHWDU\FRQWUROLVDWWKHIXQGOHYHOIRUWKHVHIXQGV7KHIROORZLQJLVDOLVWLQJRIIXQGVZKRVHH[SHQGLWXUHVH[FHHGEXGJHWDSSURSULDWLRQV)LQDO2YHU%XGJHW$FWXDO%XGJHW'HEW6HUYLFH)XQG &RQVWUXFWLRQ)XQG %UDHPDU0HPRULDO)XQG&'%*)XQG([FHVVH[SHQGLWXUHVLQWKHGHEWVHUYLFHIXQGDUHWKHUHVXOWRIKLJKHUWKDQDQWLFLSDWHGFRVWVUHODWHGWRWKHLVVXDQFHRIQHZGHEWDVZHOODVWRWDOLQWHUHVWSD\PHQWV([FHVVH[SHQGLWXUHVLQWKHFRQVWUXFWLRQIXQGDUHWKHUHVXOWRIWKHWLPLQJRIVHYHUDOODUJHUFRQVWUXFWLRQSURMHFWV([FHVVH[SHQGLWXUHVLQWKHUHPDLQLQJIXQGVDUHGXHWRVOLJKWO\KLJKHUWKDQDQWLFLSDWHGFRVWV127( 3(16,21,1)250$7,21*HQHUDO(PSOR\HHV5HWLUHPHQW)XQG&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHLQYHVWPHQWUHWXUQDQGVLQJOHGLVFRXQWUDWHVZHUHFKDQJHGIURPWRIRUILQDQFLDOUHSRUWLQJSXUSRVHVx 7KH PRUWDOLW\ LPSURYHPHQW VFDOH ZDV FKDQJHG IURP 6FDOH03 WR 6FDOH03&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQVx 7KHSULFHLQIODWLRQDVVXPSWLRQZDVGHFUHDVHGIURPWRx 7KHSD\UROOJURZWKDVVXPSWLRQZDVGHFUHDVHGIURPWRx $VVXPHGVDODU\LQFUHDVHUDWHVZHUHFKDQJHGDVUHFRPPHQGHGLQWKH-XQH H[SHULHQFHVWXG\7KHQHWHIIHFWLVDVVXPHGUDWHVWKDWDYHUDJHOHVVWKDQSUHYLRXVUDWHVx $VVXPHGUDWHVRIUHWLUHPHQWZHUHFKDQJHGDVUHFRPPHQGHGLQWKH-XQH H[SHULHQFH VWXG\ 7KH FKDQJHV UHVXOW LQ PRUH XQUHGXFHG QRUPDO UHWLUHPHQWVDQGVOLJKWO\IHZHU5XOHRI DQGHDUO\UHWLUHPHQWV&,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' *HQHUDO(PSOR\HHV5HWLUHPHQW)XQG &RQWLQXHG &KDQJHV &RQWLQXHG &KDQJHVLQ$FWXDULDO$VVXPSWLRQV &RQWLQXHG x $VVXPHGUDWHVRIWHUPLQDWLRQZHUHFKDQJHGDVUHFRPPHQGHGLQWKH-XQH H[SHULHQFHVWXG\7KHQHZUDWHVDUHEDVHGRQVHUYLFHDQGDUHJHQHUDOO\ORZHU WKDQ WKH SUHYLRXV UDWHV IRU \HDUV WZR WKURXJK ILYH DQG VOLJKWO\ KLJKHUWKHUHDIWHUx $VVXPHGUDWHVRIGLVDELOLW\ZHUHFKDQJHGDVUHFRPPHQGHGLQWKH-XQH H[SHULHQFHVWXG\7KHFKDQJHUHVXOWVLQIHZHUSUHGLFWHGGLVDELOLW\UHWLUHPHQWVIRUPDOHVDQGIHPDOHVx 7KH EDVH PRUWDOLW\ WDEOH IRU KHDOWK\ DQQXLWDQWV DQG HPSOR\HHVZDV FKDQJHGIURP WKH 53 WDEOH WR WKH 3XE *HQHUDO 0RUWDOLW\ WDEOH ZLWKDGMXVWPHQWV7KHEDVHPRUWDOLW\WDEOHIRUGLVDEOHGDQQXLWDQWVZDVFKDQJHGIURPWKH53GLVDEOHGDQQXLWDQWPRUWDOLW\WDEOHWRWKH38%*HQHUDO7HDFKHUGLVDEOHGDQQXLWDQWPRUWDOLW\WDEOHZLWKDGMXVWPHQWVx 7KH PRUWDOLW\ LPSURYHPHQW VFDOH ZDVFKDQJHG IURP 6FDOH03WR6FDOH03 x 7KH DVVXPHG VSRXVH DJH GLIIHUHQFH ZDV FKDQJHG IURP WZR \HDUV ROGHU IRUIHPDOHVWRRQH\HDUROGHUx 7KHDVVXPHGQXPEHURIPDUULHGPDOHQHZUHWLUHHVHOHFWLQJWKH-RLQW 6XUYLYRU RSWLRQFKDQJHGIURPWR 7KHDVVXPHG QXPEHURIPDUULHGIHPDOHQHZUHWLUHHVHOHFWLQJWKH-RLQW 6XUYLYRURSWLRQFKDQJHGIURPWR 7KH FRUUHVSRQGLQJ QXPEHU RI PDUULHG QHZ UHWLUHHV HOHFWLQJ WKH /LIHDQQXLW\RSWLRQZDVDGMXVWHGDFFRUGLQJO\&KDQJHVLQ3ODQ3URYLVLRQVx $XJPHQWDWLRQIRUFXUUHQWSULYDWL]HGPHPEHUVZDVUHGXFHGWRIRUWKHSHULRG-XO\ WKURXJK 'HFHPEHU DQG DIWHU $XJPHQWDWLRQ ZDVHOLPLQDWHGIRUSULYDWL]DWLRQVRFFXUULQJDIWHU-XQH &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQVx 7KHPRUDOLW\SURMHFWLRQVFDOHZDVFKDQJHGIURP03WR03&KDQJHVLQ3ODQ3URYLVLRQVx 7KHHPSOR\HUVXSSOHPHQWDOFRQWULEXWLRQZDVFKDQJHGSURVSHFWLYHO\GHFUHDVLQJIURP PLOOLRQ WR PLOOLRQ SHU \HDU 7KH 6WDWH¶V VSHFLDO IXQGLQJFRQWULEXWLRQ ZDV FKDQJHG SURVSHFWLYHO\ UHTXLULQJ PLOOLRQGXHSHU\HDUWKURXJKA-47 &,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' *HQHUDO(PSOR\HHV5HWLUHPHQW)XQG &RQWLQXHG &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHPRUWDOLW\SURMHFWLRQVFDOHZDVFKDQJHGIURP03WR03x 7KHDVVXPHGEHQHILWLQFUHDVHZDVFKDQJHGIURPSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHUWRSHU\HDU&KDQJHVLQ3ODQ3URYLVLRQVx 7KHDXJPHQWDWLRQDGMXVWPHQWLQHDUO\UHWLUHPHQWIDFWRUVLVHOLPLQDWHGRYHUDILYH\HDUSHULRGVWDUWLQJ-XO\ UHVXOWLQJLQDFWXDULDOHTXLYDOHQFHDIWHU-XQHx ,QWHUHVW FUHGLWHG RQ PHPEHU FRQWULEXWLRQV GHFUHDVHG IURP WR EHJLQQLQJ-XO\x 'HIHUUHG DXJPHQWDWLRQ ZDV FKDQJHG WR HIIHFWLYH -DQXDU\ $XJPHQWDWLRQWKDWKDVDOUHDG\DFFUXHGIRUGHIHUUHGPHPEHUVZLOOVWLOODSSO\x &RQWULEXWLRQVWDELOL]HUSURYLVLRQVZHUHUHSHDOHGx 3RVWUHWLUHPHQW EHQHILW LQFUHDVHV ZHUH FKDQJHG IURP SHU \HDU ZLWK DSURYLVLRQ WR LQFUHDVH WR XSRQ DWWDLQPHQW RI IXQGLQJ UDWLR WRRIWKH6RFLDO6HFXULW\&RVWRI/LYLQJ$GMXVWPHQWQRWOHVVWKDQDQGQRWPRUHWKDQEHJLQQLQJ-DQXDU\ x )RUUHWLUHPHQWVRQRUDIWHU-DQXDU\WKHILUVWEHQHILWLQFUHDVHLVGHOD\HGXQWLOWKHUHWLUHHUHDFKHVQRUPDOUHWLUHPHQWDJH GRHVQRWDSSO\WR5XOHRI UHWLUHHVGLVDELOLW\EHQHILWUHFLSLHQWVRUVXUYLYRUVx $FWXDULDOHTXLYDOHQWIDFWRUVZHUHXSGDWHGWRUHIOHFWUHYLVHGPRUWDOLW\DQGLQWHUHVWDVVXPSWLRQV&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KH&RPELQHG6HUYLFH$QQXLW\ &6$ ORDGVZHUHFKDQJHGIURPIRUDFWLYHPHPEHUVDQGIRUYHVWHGDQGQRQYHVWHGGHIHUUHGPHPEHUV7KHUHYLVHG&6$ORDGVDUHQRZIRUDFWLYHPHPEHUOLDELOLW\IRUYHVWHGGHIHUUHGPHPEHUOLDELOLW\DQGIRUQRQYHVWHGGHIHUUHGPHPEHUOLDELOLW\x 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPSHU\HDUIRUDOO\HDUVWRSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHU&KDQJHVLQ3ODQ3URYLVLRQVx 7KH6WDWH¶VFRQWULEXWLRQIRUWKH0LQQHDSROLV(PSOR\HHV5HWLUHPHQW)XQGHTXDOVLQDQGDQGWKHUHDIWHUx 7KH (PSOR\HU 6XSSOHPHQWDO &RQWULEXWLRQ IRU WKH 0LQQHDSROLV (PSOR\HHV5HWLUHPHQW)XQGFKDQJHGIURPWRLQFDOHQGDU\HDUV WR7KHVWDWH¶VFRQWULEXWLRQFKDQJHGIURPWRLQFDOHQGDU\HDUV WR&,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' *HQHUDO(PSOR\HHV)XQG5HWLUHPHQW)XQG &RQWLQXHG &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHUWRSHU\HDUIRUDOO\HDUVx 7KHDVVXPHGLQYHVWPHQWUHWXUQZDVFKDQJHGIURP WR7KH VLQJOHGLVFRXQWUDWHZDVFKDQJHGIURP WRx 2WKHU DVVXPSWLRQV ZHUH FKDQJHG SXUVXDQW WR WKH H[SHULHQFH VWXG\ GDWHG-XQH 7KH DVVXPHG IXWXUH VDODU\ LQFUHDVHV SD\UROO JURZWK DQGLQIODWLRQZHUHGHFUHDVHGE\WRIRUSD\UROOJURZWKDQG IRULQIODWLRQ&KDQJHVLQ3ODQ3URYLVLRQVx 7KHUHKDYHEHHQQRFKDQJHVVLQFHWKHSULRUYDOXDWLRQ&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHUWRSHU\HDUWKURXJKDQGx SHU\HDUWKHUHDIWHU&KDQJHVLQ3ODQ3URYLVLRQV x 2Q-DQXDU\WKH0LQQHDSROLV(PSOR\HHV5HWLUHPHQW)XQGZDVPHUJHGLQWRWKH*HQHUDO(PSOR\HHV)XQGZKLFKLQFUHDVHGWKHWRWDOSHQVLRQOLDELOLW\E\ELOOLRQDQGLQFUHDVHGWKHILGXFLDU\SODQQHWSRVLWLRQE\ PLOOLRQ8SRQFRQVROLGDWLRQVWDWHDQGHPSOR\HUFRQWULEXWLRQVZHUHUHYLVHG3XEOLF(PSOR\HHV3ROLFHDQG)LUH)XQG&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHLQYHVWPHQWUHWXUQDQGVLQJOHGLVFRXQWUDWHVZHUHFKDQJHGIURPWRIRUILQDQFLDOUHSRUWLQJSXUSRVHVx 7KHLQIODWLRQDVVXPSWLRQZDVFKDQJHGIURPWRx 7KHSD\UROOJURZWKDVVXPSWLRQZDVFKDQJHGIURPWRx 7KH EDVH PRUWDOLW\ WDEOH IRU KHDOWK\ DQQXLWDQWV DQG HPSOR\HHVZDV FKDQJHGIURP WKH 53 WDEOH WR WKH 3XE 3XEOLF 6DIHW\ 0RUWDOLW\WDEOH 7KHPRUWDOLW\LPSURYHPHQWVFDOHZDVFKDQJHGIURP03 WR01x 7KHEDVHPRUWDOLW\WDEOHIRUGLVDEOHGDQQXLWDQWVZDVFKDQJHGIURPWKH53KHDOWK\DQQXLWDQWPRUWDOLW\WDEOH ZLWKIXWXUHPRUWDOLW\LPSURYHPHQWDFFRUGLQJWR6FDOH03 WRWKH3XE3XEOLF6DIHW\GLVDEOHGDQQXLWDQWPRUWDOLW\WDEOH ZLWKIXWXUHPRUWDOLW\LPSURYHPHQWDFFRUGLQJWR6FDOH03 x $VVXPHGUDWHVRIVDODU\LQFUHDVHZHUHPRGLILHGDVUHFRPPHQGHGLQWKH-XO\H[SHULHQFHVWXG\7KHRYHUDOOLPSDFWLVDGHFUHDVHLQJURVVVDODU\LQFUHDVHUDWHVx $VVXPHG UDWHV RI UHWLUHPHQW ZHUH FKDQJHG DV UHFRPPHQGHG LQ WKH-XO\ H[SHULHQFH VWXG\ 7KH FKDQJHV UHVXOW LQ VOLJKWO\ PRUH XQUHGXFHGUHWLUHPHQWVDQGIHZHUDVVXPHGHDUO\UHWLUHPHQWVA-48 &,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' 3XEOLF(PSOR\HHV3ROLFHDQG)LUH)XQG &RQWLQXHG &KDQJHV &RQWLQXHG x $VVXPHGUDWHVRIZLWKGUDZDOZHUHFKDQJHGIURPVHOHFWDQGXOWLPDWH UDWHV WRVHUYLFHEDVHGUDWHV7KHFKDQJHVUHVXOWLQPRUHDVVXPHGWHUPLQDWLRQVx $VVXPHGUDWHVRIGLVDELOLW\ZHUHLQFUHDVHGIRUDJHVDQGGHFUHDVHGIRUDJHVRYHU 2YHUDOOSURSRVHGUDWHVUHVXOWLQPRUHSURMHFWHGGLVDELOLWLHVx $VVXPHGSHUFHQWPDUULHGIRUDFWLYHIHPDOHPHPEHUVZDVFKDQJHGIURPWR0LQRUFKDQJHVWRIRUPRISD\PHQWDVVXPSWLRQVZHUHDSSOLHG&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQVx 7KHPRUDOLW\SURMHFWLRQVFDOHZDVFKDQJHGIURP03WR03 &KDQJHVLQ3ODQ3URYLVLRQVx 7KHUHKDYHEHHQQRFKDQJHVVLQFHWKHSULRUYDOXDWLRQ &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQVx 7KHPRUDOLW\SURMHFWLRQVFDOHZDVFKDQJHGIURP03WR03&KDQJHVLQ3ODQ3URYLVLRQVx 7KHUHKDYHEHHQQRFKDQJHVVLQFHWKHSULRUYDOXDWLRQx&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHPRUWDOLW\SURMHFWLRQVFDOHZDVFKDQJHGIURP03WR03&KDQJHVLQ3ODQ3URYLVLRQVx 3RVWUHWLUHPHQWEHQHILWLQFUHDVHVZHUHFKDQJHGWRIRUDOO\HDUVZLWKQRWULJJHUx $Q HQG GDWH RI -XO\ ZDV DGGHG WR WKH H[LVWLQJ PLOOLRQ VWDWHFRQWULEXWLRQx 1HZDQQXDOVWDWHDLGZLOOHTXDOPLOOLRQLQILVFDO\HDUV DQGDQG PLOOLRQWKHUHDIWHUXQWLOWKHSODQUHDFKHVIXQGLQJRU-XO\LIHDUOLHUx 0HPEHUFRQWULEXWLRQVZHUHFKDQJHGIURPWRRISD\HIIHFWLYH-DQXDU\ DQGRISD\HIIHFWLYH-DQXDU\x (PSOR\HUFRQWULEXWLRQVZHUHFKDQJHGIURPWR RISD\HIIHFWLYH-DQXDU\ DQGRISD\HIIHFWLYH-DQXDU\x ,QWHUHVW FUHGLWHG RQ PHPEHU FRQWULEXWLRQV GHFUHDVHG IURP WR EHJLQQLQJ-XO\x 'HIHUUHG DXJPHQWDWLRQ ZDV FKDQJHG WR HIIHFWLYH -DQXDU\ $XJPHQWDWLRQWKDWKDVDOUHDG\DFFUXHGIRUGHIHUUHGPHPEHUVZLOOVWLOODSSO\x $FWXDULDOHTXLYDOHQWIDFWRUVZHUHXSGDWHGWRUHIOHFWUHYLVHGPRUWDOLW\DQGLQWHUHVWDVVXPSWLRQV&,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' 3XEOLF(PSOR\HHV3ROLFHDQG)LUH)XQG &RQWLQXHG &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV &RQWLQXHG x $VVXPHGVDODU\LQFUHDVHVZHUHFKDQJHGDVUHFRPPHQGHGLQWKH-XQHH[SHULHQFHVWXG\7KHQHWHIIHFW LVSURSRVHG UDWHV WKDWDYHUDJHORZHUWKDQWKHSUHYLRXVUDWHVx $VVXPHGUDWHVRIUHWLUHPHQWZHUHFKDQJHGUHVXOWLQJLQIHZHUUHWLUHPHQWVx 7KH&RPELQHG6HUYLFH$QQXLW\ &6$ ORDGZDVIRUYHVWHGDQGQRQYHVWHGGHIHUUHGPHPEHUV7KH&6$KDVEHHQFKDQJHGWRIRUYHVWHGPHPEHUVDQGIRUQRQYHVWHGPHPEHUVx 7KHEDVHPRUWDOLW\WDEOHIRUKHDOWK\DQQXLWDQWVZDVFKDQJHGIURPWKH53IXOO\JHQHUDWLRQDOWDEOHWRWKH53IXOO\JHQHUDWLRQDOWDEOH ZLWKDEDVH\HDURI ZLWKPDOHUDWHVDGMXVWHGE\DIDFWRURI 7KHPRUWDOLW\LPSURYHPHQWVFDOHZDVFKDQJHGIURP6FDOH$$WR6FDOH037KHEDVHPRUWDOLW\WDEOHIRUGLVDEOHGDQQXLWDQWVZDVFKDQJHGIURPWKH53GLVDEOHGPRUWDOLW\WDEOHWRWKHPRUWDOLW\WDEOHVDVVXPHGIRUKHDOWK\UHWLUHHVx $VVXPHGWHUPLQDWLRQUDWHVZHUHGHFUHDVHGWRIRUWKHILUVWWKUHH\HDUVRIVHUYLFH5DWHVEH\RQGWKHVHOHFWSHULRGRIWKUHH\HDUVZHUHDGMXVWHGUHVXOWLQJLQPRUHH[SHFWHGWHUPLQDWLRQVRYHUDOOx $VVXPHGSHUFHQWDJHRIPDUULHGIHPDOHPHPEHUVZDVGHFUHDVHGIURPWRx $VVXPHG DJH GLIIHUHQFH ZDV FKDQJHG IURP VHSDUDWH DVVXPSWLRQV IRU PDOHPHPEHUV ZLYHV DVVXPHG WR EH WKUHH \HDUV \RXQJHU DQG IHPDOH PHPEHUV KXVEDQGVDVVXPHGWREHIRXU\HDUVROGHU WRWKHDVVXPSWLRQWKDWPDOHVDUHWZR\HDUVROGHUWKDQIHPDOHVx 7KH DVVXPHG SHUFHQWDJH RI IHPDOH PHPEHUV HOHFWLQJ -RLQW DQG 6XUYLYRUDQQXLWLHVZDVLQFUHDVHGx 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPIRUDOO\HDUVWRSHU\HDUWKURXJKDQGWKHUHDIWHUx 7KHVLQJOHGLVFRXQWUDWHFKDQJHGIURPWRSHUDQQXP&KDQJHVLQ3ODQ3URYLVLRQVx 7KHUHKDYHEHHQQRFKDQJHVVLQFHWKHSULRUYDOXDWLRQ&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPSHU\HDUWKURXJKDQGWKHUHDIWHUWRSHU\HDUIRUDOOIXWXUH\HDUVx 7KHDVVXPHGLQYHVWPHQWUHWXUQZDVFKDQJHGIURP WR7KH VLQJOHGLVFRXQWUDWHFKDQJHGIURP WRx 7KH DVVXPHG IXWXUH VDODU\ LQFUHDVHV SD\UROO JURZWK DQG LQIODWLRQ ZHUHGHFUHDVHGE\WRIRUSD\UROOJURZWKDQGIRULQIODWLRQ&KDQJHVLQ3ODQ3URYLVLRQVx 7KHUHKDYHEHHQQRFKDQJHVVLQFHWKHSULRUYDOXDWLRQA-49 &,7<2)(',1$0,11(627$127(6725(48,5('6833/(0(17$5<,1)250$7,21<($5(1'(''(&(0%(5 127( 3(16,21,1)250$7,21 &217,18(' 3XEOLF(PSOR\HHV3ROLFHDQG)LUH)XQG &RQWLQXHG &KDQJHV&KDQJHVLQ3ODQ3URYLVLRQV x 7KH SRVWUHWLUHPHQW EHQHILW LQFUHDVH WR EH SDLG DIWHU DWWDLQPHQWRIWKH IXQGLQJWKUHVKROGZDVFKDQJHGIURPLQIODWLRQXSWRWRDIL[HGUDWHRI&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHDVVXPHGSRVWUHWLUHPHQWEHQHILWLQFUHDVHUDWHZDVFKDQJHGIURPSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHUWRSHU\HDUWKURXJKDQGSHU\HDUWKHUHDIWHU127( 27+(53267(03/2<0(17%(1(),76,1)250$7,212WKHU3RVWHPSOR\PHQW%HQHILWV3ODQ&KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHGLVFRXQWUDWHZDVFKDQJHGIURP WRx 7KHSD\UROOJURZWKUDWHZDVFKDQJHGIURPWR &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHGLVFRXQWUDWHZDVFKDQJHGIURPWR &KDQJHV&KDQJHVLQ$FWXDULDO$VVXPSWLRQV x 7KHGLVFRXQWUDWHZDVFKDQJHGIURPWR 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ A-50 1210$-25*29(510(17$/)81'66SHFLDO5HYHQXH)XQGV$6SHFLDO5HYHQXH)XQGLVXVHGWRDFFRXQWIRUWKHSURFHHGVRIVSHFLILFUHYHQXHVRXUFHVWKDWDUHOHJDOO\UHVWULFWHGWRH[SHQGLWXUHVIRUVSHFLILHGSXUSRVHV7KHIROORZLQJDUHQRQPDMRUVSHFLDOUHYHQXHIXQGV &RPPXQLW\'HYHORSPHQW%ORFN*UDQW)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVUHFHLYHGXQGHU7LWOH,RIWKH+RXVLQJDQG&RPPXQLW\'HYHORSPHQW$FWRI 3ROLFH)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVUHFHLYHGIRUVSHFLILFSXUSRVHVZLWKLQWKHSROLFHGHSDUWPHQWLQFOXGLQJ( DQG)RUIHLWXUHIXQGV%UDHPDU0HPRULDO)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVGRQDWHGWRWKH&LW\IRUWKHSXUSRVHRIHQKDQFLQJWKH%UDHPDUJROIFRXUVHZLWKHTXLSPHQWDQGDPHQLWLHVWKDWPLJKWQRWRWKHUZLVHEHDIIRUGDEOHRUYLHZHGDVDQHFHVVLW\WRWKHJROIFRXUVH3HGHVWULDQDQG&\FOLVW6DIHW\)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVUHFHLYHGIURPJDVDQGHOHFWULFIUDQFKLVHIHHVWREHXVHGIRUSHGHVWULDQDQGF\FOLVWLPSURYHPHQWVLQFOXGHGLQIXWXUHVWUHHWUHFRQVWUXFWLRQSURMHFWV$UWVDQG&XOWXUH)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVGRQDWHGWRWKH&LW\IRUWKHSXUSRVHRIHQKDQFLQJSXEOLFDUWVDQGFXOWXUHUHODWHGDFWLYLWLHV7KLVIXQGZDVFORVHGLQWRWKH*HQHUDO)XQGLQ&RQVHUYDWLRQDQG6XVWDLQDELOLW\)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUIXQGVUHFHLYHGIURPJDVDQGHOHFWULFIUDQFKLVHIHHVWREHXVHGIRULQLWLDWLYHVIRFXVHGRQFRQVHUYDWLRQDQGVXVWDLQDELOLW\&,7<2)(',1$0,11(627$&20%,1,1*%$/$1&(6+((71210$-25*29(510(17$/)81'6'(&(0%(5 &RPPXQLW\3HGHVWULDQ&RQVHUYDWLRQ 7RWDO1RQPDMRU'HYHORSPHQW%UDHPDU DQG&\FOLVW $UWVDQG DQG *RYHUQPHQWDO%ORFN*UDQW 3ROLFH 0HPRULDO 6DIHW\ &XOWXUH 6XVWDLQDELOLW\ )XQGV&DVKDQG,QYHVWPHQWV $FFUXHG,QWHUHVW $FFRXQWV5HFHLYDEOH 'XHIURP2WKHU*RYHUQPHQWV 3UHSDLG,WHPV 7RWDO$VVHWV /LDELOLWLHV $FFRXQWV3D\DEOH 6DODULHV3D\DEOH &RQWUDFWV3D\DEOH 7RWDO/LDELOLWLHV )XQG%DODQFH 1RQVSHQGDEOH 5HVWULFWHG 7RWDOIXQGEDODQFH 7RWDO/LDELOLWLHV'HIHUUHG,QIORZVRI5HVRXUFHVDQG)XQG%DODQFH 6SHFLDO5HYHQXH$VVHWV/LDELOLWLHV'HIHUUHG,QIORZVRI5HVRXUFHVDQG)XQG%DODQFHA-51 &,7<2)(',1$0,11(627$&20%,1,1*67$7(0(172)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(61210$-25*29(510(17$/)81'6<($5(1'(''(&(0%(5 &RPPXQLW\3HGHVWULDQ&RQVHUYDWLRQ 7RWDO1RQPDMRU'HYHORSPHQW%UDHPDU DQG&\FOLVW $UWVDQG DQG *RYHUQPHQWDO%ORFN*UDQW 3ROLFH 0HPRULDO 6DIHW\ &XOWXUH 6XVWDLQDELOLW\ )XQGV5(9(18(6)UDQFKLVH7D[HV ,QWHUJRYHUQPHQWDO,QYHVWPHQW,QFRPH /RVV 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV &DSLWDO2XWOD\ 3XEOLF:RUNV 7RWDO([SHQGLWXUHV 5HYHQXHV2YHU 8QGHU ([SHQGLWXUHV 2WKHU)LQDQFLQJ8VHV 7UDQVIHUV2XW 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 6SHFLDO5HYHQXH&,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±&20081,7<'(9(/230(17%/2&.*5$176&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6,QWHUJRYHUQPHQWDO(;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW&RQWUDFWXDO6HUYLFHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\)81'%$/$1&('(&(0%(5%XGJHWHG$PRXQWVA-52 &,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±32/,&(6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6,QYHVWPHQW,QFRPH2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3XEOLF6DIHW\ &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV &DSLWDO2XWOD\ 3XEOLF6DIHW\ 7RWDO([SHQGLWXUHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5%XGJHWHG$PRXQWV&,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±%5$(0$50(025,$/6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6,QYHVWPHQW,QFRPH 'RQDWLRQV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3DUNVDQG5HFUHDWLRQ &RQWUDFWXDO6HUYLFHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5%XGJHWHG$PRXQWVA-53 &,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±3('(675,$1$1'&<&/,676$)(7<6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6)UDQFKLVH7D[HV ,QYHVWPHQW,QFRPH 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3XEOLF:RUNV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV &DSLWDO2XWOD\ 3XEOLF:RUNV 7RWDO([SHQGLWXUHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 %XGJHWHG$PRXQWV&,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±$576$1'&8/785(6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6*HQHUDO3URSHUW\7D[HV ,QYHVWPHQW,QFRPH 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3DUNV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV2XW 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQGEDODQFH-DQXDU\ )81'%$/$1&('(&(0%(5%XGJHWHG$PRXQWVA-54 &,7<2)(',1$0,11(627$63(&,$/5(9(18()81'±&216(59$7,21$1'6867$,1$%,/,7<6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6)UDQFKLVH7D[HV ,QYHVWPHQW,QFRPH /RVV 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW 3XEOLF:RUNV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV,QWHUQDO6HUYLFHV &DSLWDO2XWOD\ 3XEOLF:RUNV 7RWDO([SHQGLWXUHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 %XGJHWHG$PRXQWV0$-25*29(510(17$/)81'6'HEW6HUYLFH)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUWKHSD\PHQWRISULQFLSDODQGLQWHUHVWRQWKH *HQHUDO 2EOLJDWLRQ 3HUPDQHQW ,PSURYHPHQW 5HYROYLQJ 3XEOLF3URMHFW5HYHQXHDQG(GLQD(PHUDOG(QHUJ\3URJUDP%RQGV&RQVWUXFWLRQ)XQG±7KLVIXQGZDVHVWDEOLVKHGWRDFFRXQWIRUYDULRXVVSHFLDODVVHVVPHQWDQGVWDWHDLGSURMHFWVWKURXJKRXWWKH&LW\7KLVIXQGDOVRSURYLGHVILQDQFLQJIRUFDSLWDOLPSURYHPHQWVDVGHVLJQDWHGLQWKH&LW\¶VFDSLWDOLPSURYHPHQWEXGJHWA-55 &,7<2)(',1$0,11(627$*29(510(17$/)81'±'(%76(59,&(6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO)LQDO$PRXQWV)LQDOEXGJHW5(9(18(6*HQHUDO3URSHUW\7D[HV 6SHFLDO$VVHVVPHQWV ,QYHVWPHQW,QFRPH 7RWDO5HYHQXHV (;3(1',785(6'HEW6HUYLFH 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV,Q %RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 %XGJHWHG$PRXQWV&,7<2)(',1$0,11(627$*29(510(17$/)81'±&216758&7,21&$3,7$/352-(&766&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(6%8'*(7$1'$&78$/<($5(1'(''(&(0%(5 $FWXDO 9DULDQFHZLWK2ULJLQDO )LQDO $PRXQWV)LQDOEXGJHW5(9(18(6*HQHUDO3URSHUW\7D[HV )UDQFKLVH7D[HV 6SHFLDO$VVHVVPHQWV /LFHQVHDQG3HUPLWV ,QWHUJRYHUQPHQWDO &KDUJHVIRU6HUYLFHV ,QYHVWPHQW,QFRPH 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV 3XEOLF6DIHW\ &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV 3XEOLF:RUNV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 3DUNV 3HUVRQDO6HUYLFHV &RQWUDFWXDO6HUYLFHV&RPPRGLWLHV&DSLWDO2XWOD\ *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 7UDQVIHUV,Q7UDQVIHUV2XW 6DOHRI&DSLWDO$VVHWV %RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 %XGJHWHG$PRXQWVA-56 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ 1210$-2535235,(7$5<)81'6(QWHUSULVH)XQGV(QWHUSULVH IXQGV DFFRXQW IRU WKH ILQDQFLQJ RI VHOIVXSSRUWLQJ DFWLYLWLHV RI JRYHUQPHQWDO XQLWV ZKLFKUHQGHUVHUYLFHVWRWKHJHQHUDOSXEOLFRQDXVHUFKDUJHEDVLV7KHIROORZLQJDUHQRQPDMRUHQWHUSULVHIXQGV $UW&HQWHU)XQG±7KLVIXQGDFFRXQWVIRUDFWLYLWLHVUHODWHGWRWKH&LW\¶V$UW&HQWHU(GLQERURXJK3DUN)XQG±7KLVIXQGDFFRXQWVIRUDFWLYLWLHVUHODWHGWR(GLQERURXJK3DUN&HQWHQQLDO/DNHV)XQG±7KLVIXQGDFFRXQWVIRUDFWLYLWLHVUHODWHGWR&HQWHQQLDO/DNHV3DUN%UDHPDU)LHOG)XQG±7KLVIXQGDFFRXQWVIRUDFWLYLWLHVUHODWHGWRWKH6SRUWV'RPHA-57 &,7<2)(',1$0,11(627$&20%,1,1*67$7(0(172)1(7326,7,211210$-2535235,(7$5<)81'6'(&(0%(5 7RWDO1RQPDMRU$UW (GLQERURXJK &HQWHQQLDO %UDHPDU 3URSULHWDU\&HQWHU 3DUN /DNHV )LHOG )XQGV$66(76&XUUHQW$VVHWV &DVKDQG,QYHVWPHQWV ,QWHUHVW5HFHLYDEOH $FFRXQWV5HFHLYDEOH 'XHIURP2WKHU*RYHUQPHQWV 7RWDO&XUUHQW$VVHWV 1RQFXUUHQW$VVHWV 1HW&DSLWDO$VVHWV 7RWDO$VVHWV '()(55('287)/2:62)5(6285&(623(%'HIHUUHG2XWIORZV3HQVLRQ'HIHUUHG2XWIORZV 7RWDO'HIHUUHG2XWIORZVRI5HVRXUFHV /,$%,/,7,(6&XUUHQW/LDELOLWLHV $FFRXQWV3D\DEOH 6DODULHV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 8QHDUQHG5HYHQXH &RPSHQVDWHG$EVHQFHV3D\DEOH7RWDO&XUUHQW/LDELOLWLHV1RQFXUUHQW/LDELOLWLHV 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ &RPSHQVDWHG$EVHQFHV3D\DEOH 7RWDO1RQFXUUHQW/LDELOLWLHV 7RWDO/LDELOLWLHV'()(55(',1)/2:62)5(6285&(623(%'HIHUUHG,QIORZV 3HQVLRQ'HIHUUHG,QIORZV 7RWDO'HIHUUHG,QIORZVRI5HVRXUFHV 1(7326,7,211HW,QYHVWPHQWLQ&DSLWDO$VVHWV 8QUHVWULFWHG 7RWDO1HW3RVLWLRQ &,7<2)(',1$0,11(627$&20%,1,1*67$7(0(172)5(9(18(6(;3(16(6$1'&+$1*(6,1)81'1(7326,7,211210$-2535235,(7$5<)81'6<($5(1'(''(&(0%(5 7RWDO1RQPDMRU$UW(GLQERURXJK &HQWHQQLDO %UDHPDU3URSULHWDU\&HQWHU3DUN/DNHV)LHOG)XQGV23(5$7,1*5(9(18(66DOHV5HWDLO6DOHV&RQFHVVLRQV 0HPEHUVKLSV $GPLVVLRQV /RGJLQJ7D[ %XLOGLQJ5HQWDO 5HQWDORI(TXLSPHQW *UHHQV)HHV &ODVV5HJLVWUDWLRQDQG2WKHU)HHV 7RWDO2SHUDWLQJ5HYHQXHV 23(5$7,1*(;3(16(6&RVWRI6DOHVDQG6HUYLFHV 3HUVRQDO6HUYLFHV ,QWHUQDO6HUYLFHV &RPPRGLWLHV ,QWHUQDO6HUYLFHV 'HSUHFLDWLRQ 7RWDO2SHUDWLQJ([SHQVHV 23(5$7,1*,1&20( /266 12123(5$7,1*5(9(18(6 (;3(16(6 ,QYHVWPHQW,QFRPH 'RQDWLRQV 0LVFHOODQHRXV7RWDO1RQRSHUDWLQJ5HYHQXHV ([SHQVHV ,1&20( /266 %()25(75$16)(56 75$16)(567UDQVIHUV,Q &+$1*(,11(7326,7,21 1HW3RVLWLRQ-DQXDU\ 1(7326,7,21'(&(0%(5 A-58 &,7<2)(',1$0,11(627$&20%,1,1*67$7(0(172)&$6+)/2:61210$-2535235,(7$5<)81'6<($5(1'(''(&(0%(5 7RWDO1RQPDMRU$UW (GLQERURXJK &HQWHQQLDO %UDHPDU3URSULHWDU\&HQWHU3DUN/DNHV)LHOG)XQGV&$6+)/2:6)52023(5$7,1*$&7,9,7,(65HFHLSWVIURP&XVWRPHUVDQG8VHUV 3D\PHQWWR6XSSOLHUV 3D\PHQWWR(PSOR\HHV 1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV &$6+)/2:6)520121&$3,7$/),1$1&,1*$&7,9,7,(67UDQVIHUIURP2WKHU)XQGV &$6+)/2:6)520&$3,7$/$1'5(/$7('),1$1&,1*$&7,9,7,(6$FTXLVLWLRQRI&DSLWDO$VVHWV &$6+)/2:6)520,19(67,1*$&7,9,7,(6,QWHUHVW5HFHLYHG 1(7,1&5($6( '(&5($6( ,1&$6+$1',19(670(176 &DVKDQG,QYHVWPHQWV-DQXDU\ &$6+$1',19(670(176'(&(0%(5 &$6+$1',19(670(17635(6(17('217+(67$7(0(172)1(7326,7,21 &DVK ,QYHVWPHQWV 7RWDO&DVKDQG,QYHVWPHQWV 5(&21&,/,$7,212)23(5$7,1*,1&20( /266 721(7&$6+3529,'(' 86(' %<23(5$7,1*$&7,9,7,(62SHUDWLQJ,QFRPH /RVV $GMXVWPHQWVWR5HFRQFLOH2SHUDWLQJ,QFRPH /RVV WR1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV 'HSUHFLDWLRQ 0LVFHOODQHRXV,QFRPH ,QFUHDVH 'HFUHDVHLQ 5HFHLYDEOHV 'XH)URP2WKHU*RYHUQPHQWV ,QYHQWRU\ 'HIHUUHG2XWIORZVRI5HVRXUFHV ,QFUHDVH 'HFUHDVH LQ $FFRXQWV3D\DEOH 6DODULHV3D\DEOH 'XHWR2WKHU*RYHUQPHQWV 8QHDUQHG5HYHQXH 7RWDO23(%/LDELOLW\ 1HW3HQVLRQ/LDELOLW\ &RPSHQVDWHG$EVHQFHV 'HIHUUHG,QIORZVRI5HVRXUFHV 7RWDO$GMXVWPHQWV 1HW&DVK3URYLGHG 8VHG E\2SHUDWLQJ$FWLYLWLHV 121&$6+,19(67,1*$&7,9,7,(6,QFUHDVH 'HFUHDVH LQ)DLU9DOXHRI,QYHVWPHQWV ),'8&,$5<)81'6&XVWRGLDO)XQGV&XVWRGLDO IXQGV DUH XVHG WR UHSRUW UHVRXUFHV KHOG E\ WKH &LW\ LQ D SXUHO\ FXVWRGLDO FDSDFLW\ 7KHIROORZLQJDUHDJHQF\IXQGV 3ROLFH6HL]XUH)XQG±7KLVIXQGDFFRXQWVIRUDVVHWVVHL]HGE\WKH3ROLFH'HSDUWPHQW3XEOLF6DIHW\7UDLQLQJ)DFLOLW\±7KLVIXQGDFFRXQWVIRUDVVHWVDQGOLDELOLWLHVRIWKH6RXWK0HWUR3XEOLF6DIHW\7UDLQLQJ)DFLOLW\ZKLFKLVDMRLQWYHQWXUHWKDWWKH&LW\KDVILGXFLDU\UHVSRQVLELOLWLHVIRU0LQQHVRWD7DVN)RUFH±7KLVIXQGDFFRXQWVIRUDVVHWVDQGOLDELOLWLHVRIWKH0LQQHVRWD7DVN)RUFHZKLFK LV FRPSULVHG RI SHUVRQQHO DQG HTXLSPHQW IURP SXEOLF VDIHW\ DQG VSHFLDOLVW SHUVRQQHO IURPVXSSRUWLQJHQWLWLHVWKDWRSHUDWHVDVSDUWRIDMRLQWSRZHUVDJUHHPHQWWKDWWKH&LW\KDVDGPLQLVWUDWLYHUHVSRQVLELOLWLHVIRUA-59 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ &,7<2)(',1$0,11(627$&20%,1,1*%$/$1&(6+((7$1'67$7(0(172)&+$1*(6,1$66(76$1'/,$%,/,7,(6&8672',$/)81'6<($5(1'(''(&(0%(5 3XEOLF6DIHW\3ROLFH 7UDLQLQJ 0LQQHVRWD6HL]XUH )DFLOLW\ 7DVN)RUFH 7RWDO&DVKDQG,QYHVWPHQWV $FFRXQWV5HFHLYDEOH 7RWDO$VVHWV $FFRXQWV3D\DEOH 6DODULHV3D\DEOH 'XHWR2WKHU*RYHUQPHQWDO8QLWV 8QHDUQHG5HYHQXH 5HVWULFWHGIRU2UJDQL]DWLRQVDQG2WKHU*RYHUQPHQWV 3XEOLF6DIHW\3ROLFH 7UDLQLQJ 0LQQHVRWD6HL]XUH )DFLOLW\ 7DVN)RUFH 7RWDO&ROOHFWLRQVRQ%HKDOIRI2WKHUV 3D\PHQWVRQ%HKDOIRI2WKHUV 1HW,QFUHDVH 'HFUHDVH LQ)LGXFLDU\1HW3RVLWLRQ 1HW3RVLWLRQ%HJLQQLQJ 1HW3RVLWLRQ(QGLQJ $'',7,216'('8&7,216$66(76/,$%,/,7,(61(7326,7,21A-60 &,7<2)(',1$0,11(627$7$;&$3$&,7<7$;/(9,(6$1'7$;&$3$&,7<5$7(6 6+2:1%<<($52)7$;&2//(&7,%,/,7< 7RWDO7D[&DSDFLW\ ,QFUHPHQW9DOXDWLRQ &RQWULEXWLRQWR)LVFDO'LVSDULWLHV3RRO 7D[&DSDFLW\8VHGIRU5DWH&DOFXODWLRQ )LVFDO'LVSDULWLHV'LVWULEXWLRQ $GMXVWHG1HW7D[&DSDFLW\ 7D[/HYLHV *HQHUDO)XQG $UWVDQG&XOWXUH)XQG(TXLSPHQW 'HEW6HUYLFH +5$2SHUDWLQJ 7RWDO&HUWLILHG7D[/HYLHV 5HIHUHQGXP0DUNHW9DOXH/HY\ 7RWDO/HY\ 7D[&DSDFLW\5DWH *HQHUDO)XQG5HYHQXH %RQGVDQG,QWHUHVW +5$ 7RWDO7D[&DSDFLW\5DWH 0DUNHW9DOXH5DWH &,7<2)(',1$0,11(627$&20%,1,1*6&+('8/(2)%21'(',1'(%7('1(66'(&(0%(5 )LQDO,QWHUHVW 0DWXULW\ 2ULJLQDO5DWHV 'DWH 'DWH ,VVXH5HGHHPHG*HQHUDO2EOLJDWLRQ%RQGV *2&DSLWDO,PSURYHPHQW3ODQ6HULHV$ *2&DSLWDO,PSURYHPHQW3ODQ6HULHV$5HIXQGLQJ *25HIXQGLQJ6HULHV$ *25HIXQGLQJ6HULHV& *2(TXLSPHQW&HUWLILFDWH6HULHV $ *25HIXQGLQJ6HULHV% 7RWDO*HQHUDO2EOLJDWLRQ%RQGV 3HUPDQHQW,PSURYHPHQW5HYROYLQJ 3,5 %RQGV *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV% *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$3DUNLQJ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV $ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV%5HIXQGLQJ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV$ *23HUPDQHQW,PSURYHPHQW5HYROYLQJ6HULHV%5HIXQGLQJ 7RWDO3,5%RQGV 7D[,QFUHPHQW)LQDQFLQJ%RQGV7,)6HULHV$ 3XEOLF3URMHFW5HYHQXH%RQGV 7D[DEOH3XEOLF3URMHFW5HYHQXH6HULHV $ +5$3XEOLF3URMHFW5HYHQXH6HULHV$ +5$3XEOLF3URMHFW5HYHQXH6HULHV$5HIXQGLQJ 7RWDO3XEOLF3URMHFW5HYHQXH%RQGV 5HYHQXH%RQGV 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV& 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV% 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV'5HIXQGLQJ 5HFUHDWLRQDO)DFLOLW\%RQGV6HULHV&5HIXQGLQJ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV $ 8WLOLW\5HYHQXH%RQGV6HULHV$ 8WLOLW\5HYHQXH%RQGV6HULHV%5HIXQGLQJ 7RWDO3XEOLF3URMHFW5HYHQXH%RQGV 7RWDO%RQGHGLQGHEWHGQHVV 3ULRU<HDUVA-61 &,7<2)(',1$0,11(627$&20%,1,1*6&+('8/(2)%21'(',1'(%7('1(66 &217,18(' '(&(0%(5 3ULQFLSDO,QWHUHVW,QWHUHVW2XWVWDQGLQJ3D\DEOH'XH'XH3D\DEOH,VVXHG3D\PHQWV,Q,QWR0DWXULW\ &,7<2)(',1$0,11(627$6&+('8/(2)%$/$1&(6+((7$&&281767$;,1&5(0(17),1$1&,1*',675,&76'(&(0%(5 &HQWHQQLDO 9DOOH\9LHZ 6RXWKGDOH 3HQWDJRQ3DUN *UDQGYLHZ WK:HVW WKDQG)UDQFH :HVWWK6WUHHW 7RWDO'LVWULFW 'LVWULFW 'LVWULFW 'LVWULFW'LVWULFW 'LVWULFW 'LVWULFW 'LVWULFW7D[,QFUHPHQW1R 1R 1R 1R 1R 1R 1R 1R)LQDQFLQJ'LVWULFWV$66(76&DVKDQG,QYHVWPHQWV $FFUXHG,QWHUHVW /RDQV5HFHLYDEOH 'XHIURP2WKHU'LVWULFWV 'XHIURP2WKHU*RYHUQPHQWV 7RWDO$VVHWV /,$%,/,7,(6$FFRXQWV3D\DEOH 6DODULHV3D\DEOH &RQWUDFWV3D\DEOH 'XHWR2WKHU'LVWULFWV 8QHDUQHG5HYHQXH 7RWDO/LDELOLWLHV )81'%$/$1&(5HVWULFWHG 7RWDO/LDELOLWLHVDQG)XQG%DODQFH A-62 &,7<2)(',1$0,11(627$6&+('8/(2)5(9(18(6(;3(1',785(6$1'&+$1*(6,1)81'%$/$1&(67$;,1&5(0(17),1$1&,1*',675,&76<($5(1'(''(&(0%(5 7RWDO7D[&HQWHQQLDO 9DOOH\9LHZ 6RXWKGDOH 3HQWDJRQ3DUN *UDQGYLHZ WK:HVW WKDQG)UDQFH :HVWWK6WUHHW ,QFUHPHQW'LVWULFW 'LVWULFW 'LVWULFW 'LVWULFW 'LVWULFW 'LVWULFW )UDQFH'LVWULFW 'LVWULFW )LQDQFLQJ1R 1R 1R 1R 1R 1R 1R 1R 'LVWULFWV5(9(18(67D[,QFUHPHQW&ROOHFWLRQV 2WKHU)HHV ,QYHVWPHQW,QFRPH 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6&XUUHQW *HQHUDO*RYHUQPHQW &DSLWDO2XWOD\ *HQHUDO*RYHUQPHQW 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 ,QWHUIXQG/RDQ,QWHUHVW %RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7,1&5($6( '(&5($6( ,1)81'%$/$1&( )XQG%DODQFH-DQXDU\ )81'%$/$1&('(&(0%(5 67$7,67,&$/6(&7,217KLVSDUWRIWKH&LW\¶VDQQXDOFRPSUHKHQVLYHILQDQFLDOUHSRUWSUHVHQWVGHWDLOHGLQIRUPDWLRQDVDFRQWH[WIRU XQGHUVWDQGLQJ ZKDW WKH LQIRUPDWLRQ LQ WKH ILQDQFLDO VWDWHPHQWV QRWH GLVFORVXUHV DQG UHTXLUHGVXSSOHPHQWDU\LQIRUPDWLRQVD\VDERXWWKH&LW\¶VRYHUDOOILQDQFLDOKHDOWK&RQWHQWV3DJH)LQDQFLDO7UHQGV 7KHVHVFKHGXOHVFRQWDLQWUHQGLQIRUPDWLRQWRKHOSWKHUHDGHUXQGHUVWDQGKRZWKH&LW\¶VILQDQFLDOSHUIRUPDQFHDQGZHOOEHLQJKDYHFKDQJHGRYHUWLPH5HYHQXH&DSDFLW\ 7KHVH VFKHGXOHV FRQWDLQ LQIRUPDWLRQ WR KHOS WKH UHDGHU DVVHVVWKH &LW\¶V PRVWVLJQLILFDQWORFDOUHYHQXHVRXUFHWKHSURSHUW\WD['HEW&DSDFLW\ 7KHVHVFKHGXOHVFRQWDLQLQIRUPDWLRQWRKHOSWKHUHDGHUDVVHVVWKHDIIRUGDELOLW\RIWKH&LW\¶VFXUUHQWOHYHOVRIRXWVWDQGLQJGHEWDQGWKH&LW\¶VDELOLW\WRLVVXHDGGLWLRQDOGHEWLQWKHIXWXUH'HPRJUDSKLFDQG(FRQRPLF,QIRUPDWLRQ 7KHVH VFKHGXOHV RIIHU GHPRJUDSKLF DQG HFRQRPLF LQGLFDWRUV WR KHOS WKH UHDGHUXQGHUVWDQGWKHHQYLURQPHQWZLWKLQZKLFKWKH&LW\¶VILQDQFLDODFWLYLWLHVWDNHSODFH2SHUDWLQJ,QIRUPDWLRQ 7KHVH VFKHGXOHV FRQWDLQ VHUYLFH DQG LQIUDVWUXFWXUH GDWD WR KHOS WKH UHDGHUXQGHUVWDQGKRZWKHLQIRUPDWLRQLQWKH&LW\¶VILQDQFLDOUHSRUWUHODWHVWRWKHVHUYLFHVWKH&LW\SURYLGHVDQGWKHDFWLYLWLHVLWSHUIRUPV6RXUFHV 8QOHVVRWKHUZLVHQRWHGWKHLQIRUPDWLRQLQWKHVHVFKHGXOHVLVGHULYHGIURPWKHDQQXDOFRPSUHKHQVLYHILQDQFLDOUHSRUWVIRUWKHUHOHYDQW\HDUA-63 7KLVSDJHOHIWEODQNLQWHQWLRQDOO\ &,7<2)(',1$0,11(627$1(7326,7,21%<&20321(17/$677(1),6&$/<($56 $&&58$/%$6,62)$&&2817,1* DE*29(510(17$/$&7,9,7,(61HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG 8QUHVWULFWHG 7RWDO*RYHUQPHQWDO $FWLYLWLHV1HW3RVLWLRQ %86,1(667<3($&7,9,7,(61HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG 8QUHVWULFWHG 7RWDO%XVLQHVV7\SH $FWLYLWLHV1HW3RVLWLRQ 35,0$5<*29(510(171HW,QYHVWPHQWLQ&DSLWDO$VVHWV 5HVWULFWHG 8QUHVWULFWHG 7RWDO3ULPDU\*RYHUQPHQW 1HW3RVLWLRQ D7KH&LW\LPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIWKLVFKDQJHLQDFFRXQWLQJSULQFLSOHE7KH&LW\LPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIWKLVFKDQJHLQDFFRXQWLQJSULQFLSOHF7KH&LW\LPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIWKLVFKDQJHLQDFFRXQWLQJSULQFLSOH)LVFDO<HDUA-64 &,7<2)(',1$0,11(627$1(7326,7,21%<&20321(17 &217,18(' /$677(1),6&$/<($56 $&&58$/%$6,62)$&&2817,1* F )LVFDO<HDU&,7<2)(',1$0,11(627$&+$1*(6,11(7326,7,21/$677(1),6&$/<($56 $&&58$/%$6,62)$&&2817,1* DEF(;3(16(6*RYHUQPHQWDO$FWLYLWLHV *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV ,QWHUHVWRQ/RQJ7HUP'HEW 7RWDO*RYHUQPHQWDO$FWLYLWLHV([SHQVHV %XVLQHVV7\SH$FWLYLWLHV :DWHU 6HZHU 6WRUPZDWHU5HF\FOLQJ/LTXRU $TXDWLF&HQWHU *ROI&RXUVH $UHQD &RPPXQLW\$FWLYLW\&HQWHUV 7RWDO%XVLQHVV7\SH$FWLYLWLHV([SHQVHV 7RWDO3ULPDU\*RYHUQPHQW([SHQVHV 352*5$05(9(18(6*RYHUQPHQWDO$FWLYLWLHV &KDUJHVIRU6HUYLFHV *HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 2WKHU$FWLYLWLHV 2SHUDWLQJ*UDQWVDQG&RQWULEXWLRQV &DSLWDO*UDQWVDQG&RQWULEXWLRQV 7RWDO*RYHUQPHQWDO$FWLYLWLHV3URJUDP5HYHQXHV %XVLQHVV7\SH$FWLYLWLHV &KDUJHVIRU6HUYLFHV :DWHU 6HZHU 6WRUPZDWHU5HF\FOLQJ/LTXRU $TXDWLF&HQWHU *ROI&RXUVH $UHQD &RPPXQLW\$FWLYLW\&HQWHUV 2SHUDWLQJ*UDQWVDQG&RQWULEXWLRQV &DSLWDO*UDQWVDQG&RQWULEXWLRQV 7RWDO%XVLQHVV7\SH$FWLYLWLHV3URJUDP5HYHQXHV 7RWDO3ULPDU\*RYHUQPHQW3URJUDP5HYHQXHV 1(7 (;3(16( 5(9(18(*RYHUQPHQWDO$FWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV 7RWDO3ULPDU\*RYHUQPHQW1HW([SHQVH *(1(5$/5(9(18(6$1'27+(5&+$1*(6,11(7326,7,21*RYHUQPHQWDO$FWLYLWLHV 3URSHUW\7D[HV 7D[,QFUHPHQW&ROOHFWLRQV )UDQFKLVH7D[HV /RGJLQJ7D[HV 8QUHVWULFWHG,QYHVWPHQW(DUQLQJV *DLQRQ'LVSRVDORI&DSLWDO$VVHWV ,QVXUDQFH5HFRYHU\ 7UDQVIHUV 7RWDO*RYHUQPHQWDO$FWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV 8QUHVWULFWHG,QYHVWPHQW(DUQLQJV *DLQ /RVV RQ'LVSRVDORI&DSLWDO$VVHWV 7UDQVIHUV 7RWDO%XVLQHVV7\SH$FWLYLWLHV 7RWDO3ULPDU\*RYHUQPHQW &+$1*(,11(7326,7,21*RYHUQPHQWDO$FWLYLWLHV %XVLQHVV7\SH$FWLYLWLHV 7RWDO3ULPDU\*RYHUQPHQW D7KH&LW\LPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIWKLVFKDQJHLQDFFRXQWLQJSULQFLSOHE7KH&LW\FRPSOHWHGDPDMRUGHSDUWPHQWDOUHRUJDQL]DWLRQLQPRYLQJSDUNVPDLQWHQDQFHDFWLYLWLHVIURPSDUNVWRSXEOLFZRUNV3ULRU\HDULQIRUPDWLRQKDVQRWEHHQPRGLILHGDVDUHVXOWRIWKLVFKDQJHF7KH&LW\LPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIWKLVFKDQJHLQDFFRXQWLQJSULQFLSOHG7KH&LW\FRPSOHWHGDPDMRUGHSDUWPHQWDOUHRUJDQL]DWLRQLQPRYLQJSDUNVPDLQWHQDQFHDFWLYLWLHVIURPSXEOLFZRUNVWRSDUNV7KH&LW\DOVRLPSOHPHQWHG*$6%LQILVFDO\HDU3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHGDVDUHVXOWRIHLWKHUFKDQJHH7KH&LW\EURNHRXWWKHYDULRXVIXQFWLRQVZLWKLQWKHXWLOLWLHVIXQGIRUWKHILUVWWLPHLQ3ULRU\HDULQIRUPDWLRQKDVQRWEHHQUHVWDWHG)LVFDO<HDUA-65 &,7<2)(',1$0,11(627$&+$1*(6,11(7326,7,21 &217,18(' /$677(1),6&$/<($56 $&&58$/%$6,62)$&&2817,1* G H )LVFDO<HDU&,7<2)(',1$0,11(627$)81'%$/$1&(62)*29(510(17$/)81'6/$677(1),6&$/<($56 02',),('$&&58$/%$6,62)$&&2817,1* D*(1(5$/)81'1RQVSHQGDEOH 5HVWULFWHG $VVLJQHG 8QDVVLJQHG 7RWDO*HQHUDO)XQG $//27+(5*29(510(17$/)81'61RQVSHQGDEOH5HVWULFWHG5HSRUWHGLQ 6SHFLDO5HYHQXH)XQGV 'HEW6HUYLFH)XQGV &RQVWUXFWLRQ)XQGV $VVLJQHG5HSRUWHGLQ &DSLWDO3URMHFWV)XQGV 8QDVVLJQHG5HSRUWHGLQ 6SHFLDO5HYHQXH)XQGV7RWDODOO2WKHU*RYHUQPHQWDO)XQGV D7KHVXEVWDQWLDOLQFUHDVHLQRWKHUJRYHUQPHQWDOIXQGVUHVWULFWHGIXQGEDODQFHLVGXHWRXQVSHQWERQGSURFHHGVUHODWHGWRWKHFXUUHQWUHIXQGLQJWKDWWRRNSODFHRQ)HEUXDU\RIWKHIROORZLQJ\HDU)LVFDO<HDUA-66 &,7<2)(',1$0,11(627$)81'%$/$1&(62)*29(510(17$/)81'6 &217,18(' /$677(1),6&$/<($56 02',),('$&&58$/%$6,62)$&&2817,1* DD )LVFDO<HDU&,7<2)(',1$0,11(627$&+$1*(6,1)81'%$/$1&(62)*29(510(17$/)81'6/$677(1),6&$/<($56 02',),('$&&58$/%$6,62)$&&2817,1* 5(9(18(6*HQHUDO3URSHUW\7D[HV 7D[,QFUHPHQW&ROOHFWLRQV )UDQFKLVH7D[HV /RGJLQJ)HHV 6SHFLDO$VVHVVPHQWV /LFHQVHDQG3HUPLWV ,QWHUJRYHUQPHQWDO &KDUJHVIRU6HUYLFHV )LQHVDQG)RUIHLWXUHV ,QYHVWPHQW,QFRPH 5HQWDORI3URSHUW\3DUNODQG'HGLFDWLRQ 2WKHU5HYHQXHV 7RWDO5HYHQXHV (;3(1',785(6*HQHUDO*RYHUQPHQW 3XEOLF6DIHW\ 3XEOLF:RUNV 3DUNV &DSLWDO2XWOD\ 'HEW6HUYLFH 3ULQFLSDO ,QWHUHVWDQG2WKHU&KDUJHV 7RWDO([SHQGLWXUHV 5(9(18(629(5 81'(5 (;3(1',785(6 27+(5),1$1&,1*6285&(6 86(6 8WLOLW\&RQWULEXWLRQVIURP2WKHU)XQGV7UDQVIHUV,Q 7UDQVIHUV2XW 6DOHRI&DSLWDO$VVHWV ,QVXUDQFH5HFRYHU\ /RDQV,VVXHG %RQGV,VVXHG 5HIXQGLQJ%RQGV,VVXHG 3UHPLXPRQ%RQGV,VVXHG 'LVFRXQWRQ%RQGV,VVXHG 3D\PHQWWR5HIXQGLQJ(VFURZ 7RWDO2WKHU)LQDQFLQJ6RXUFHV 8VHV 1(7&+$1*(,1)81'%$/$1&(6 'HEW6HUYLFHDVD3HUFHQWDJHRI1RQFDSLWDO([SHQGLWXUHV )LVFDO<HDUA-67 &,7<2)(',1$0,11(627$&+$1*(6,1)81'%$/$1&(62)*29(510(17$/)81'6 &217,18(' /$677(1),6&$/<($56 02',),('$&&58$/%$6,62)$&&2817,1* )LVFDO<HDU&,7<2)(',1$0,11(627$$66(66('9$/8($&78$/9$/8($1'7$;&$3$&,7<2)7$;$%/(3523(57</$677(1),6&$/<($56 &LW\7D[ &LW\8VHG $GMXVWHG &DSDFLW\ 5HIHUHQGXP(VWLPDWHG /LPLWHG 7D[DEOH 7RWDO IRU5DWH 1HW 5DWH 5DWH 6RXUFH +HQQHSLQ&RXQW\7D[SD\HU6HUYLFHVD3URSHUW\LQWKH&LW\LVDVVHVVHGDQQXDOO\$VVHVVHGYDOXHLVHTXDOWRPDUNHWYDOXHDOWKRXJKWD[DEOHYDOXHPD\EHGLIIHUHQWDVVKRZQ7KH&LW\UHFHLYHVUHSRUWVIURP+HQQHSLQ&RXQW\VKRZLQJWRWDOPDUNHWYDOXHEXWQRWVHSDUDWHGE\SURSHUW\FODVVLILFDWLRQE7KLVYDOXHLVHVWLPDWHGE\WKH&LW\)LQDQFH'HSDUWPHQWE\WDNLQJ&LW\WD[HVDVDUDWHRIHVWLPDWHGPDUNHWYDOXH UDWHSHURIDVVHVVHGYDOXH 7KHSURSHUW\WD[V\VWHPLQ0LQQHVRWDXVHVDWD[FDSDFLW\V\VWHPZKHUHE\HDFKSDUFHOLVDVVLJQHGDWD[FDSDFLW\EDVHGRQWD[DEOHYDOXHDQGFODVV,Q0LQQHVRWDORFDOWD[HVDUHXVXDOO\H[SUHVVHGDVDSHUFHQWDJHRIWKLVFDOFXODWHGWD[FDSDFLW\ VHHFROXPQWLWOHG&LW\7D[&DSDFLW\5DWH 7KHUHIRUHWKLVUDWHLVRQO\WKHRUHWLFDODQGVKRZQIRUFRPSDUDWLYHSXUSRVHVRQO\(VWLPDWHG5DWHE0DUNHW9DOXH ,Q7KRXVDQGV D7D[&DSDFLW\ ,Q7KRXVDQGV )LVFDO'LUHFW <HDUA-68 &,7<2)(',1$0,11(627$',5(&7$1'29(5/$33,1*7$;&$3$&,7<5$7(6/$677(1),6&$/<($56 7RWDO%DVLF 'HEW +5$ 7RWDO7D[ 'LUHFWDQG5DWH 5DWH 5DWH &DSDFLW\ 509 +HQQHSLQ 7D[&DS 509 2WKHU 2YHUODS 6RXUFH +HQQHSLQ&RXQW\7D[SD\HU6HUYLFHV509 5HIHUHQGXP0DUNHW9DOXH*HRJUDSKLFERXQGDULHVIRURYHUODSSLQJGLVWULFWDUHQRWLGHQWLFDOWRWKH&LW\ VERXQGDULHV&LW\ERXQGDULHVFRQWDLQVL[GLIIHUHQWVFKRROGLVWULFWVEXWRQO\,6'LVVKRZQKHUH2WKHUGLVWULFWVLQFOXGH0RVTXLWR&RQWURO0HW&RXQFLO0HWUR7UDQVLW+HQQHSLQ3DUNV3DUN0XVHXPDQG5HJLRQDO5DLOURDG$XWKRULW\,QDGGLWLRQWKHUHDUHWZRZDWHUVKHGGLVWULFWVLQWKH&LW\1LQH0LOH&UHHNDQG0LQQHKDKD&UHHNDQGUDWHVIRU1LQH0LOHDUHLQFOXGHGLQ2WKHU7RWDOUDWHVGRQRWLQFOXGH509UDWHV &LW\5DWHV2YHUODSSLQJ5DWHV,6'(GLQD)LVFDO<HDU&,7<2)(',1$0,11(627$35,1&,3$/3523(57<7$;3$<(56&855(17<($5$1'1,1(<($56$*2 3HUFHQWDJH3HUFHQWDJHRI7RWDORI7RWDO7D[&DSDFLW\ 5DQN &DSDFLW\ 7D[&DSDFLW\ 5DQN &DSDFLW\*DOOHULD6KRSSLQJ&HQWHU 6RXWKGDOH6KRSSLQJ&HQWHU 6RXWKGDOH0HGLFDO%XLOGLQJ 6RXWKGDOH2IILFH&HQWHU 2Q\[$SDUWPHQWV '1$ '1$ '1$/RGHQ$SDUWPHQWV '1$ '1$ '1$&HQWHQQLDO/DNHV3KDVH9 &HQWHQQLDO/DNHV3KDVH,9 2QH6RXWKGDOH3ODFH$SDUWPHQWV '1$ '1$ '1$/LIHWLPH)LWQHVV/LIHWLPH:RUNV '1$ '1$ '1$&HQWHQQLDO/DNHV5HWDLO'1$ '1$ '1$ 1DWLRQDO&DU'1$ '1$ '1$ 7DUJHW'1$ '1$ '1$ +HOOPXWK -RKQVRQ'1$ '1$ '1$ 7RWDOV 6RXUFH &LW\RI(GLQD$VVHVVLQJ2IILFH'1$ 'DWDLVQRWDYDLODEOH7D[SD\HUA-69 &,7<2)(',1$0,11(627$3523(57<7$;/(9,(6$1'&2//(&7,216/$677(1),6&$/<($56 7RWDO&ROOHFWLRQVLQ7D[3HUFHQWDJH 6XEVHTXHQW3HUFHQWDJH/HY\$PRXQW RI/HY\ <HDUV $PRXQW RI/HY\ 6RXUFH +HQQHSLQ&RXQW\7D[SD\HU6HUYLFHV&ROOHFWHGZLWKLQWKH)LVFDO<HDURIWKH/HY\7RWDO&ROOHFWLRQVWR'DWH7D[HV3D\DEOH &,7<2)(',1$0,11(627$5$7,262)28767$1',1*'(%7%<7<3(/$677(1),6&$/<($56 '2//$56,17+286$1'6(;&(373(5&$3,7$ *HQHUDO 3XEOLF 7D[ 3HUPDQHQW (((35HF 8WLOLW\ 7RWDO3HUFHQWDJH2EOLJDWLRQ 3URMHFW ,QFUHPHQW ,PSURYHPHQW 5HYHQXH 1RWHV )DFLOLW\ 5HYHQXH 3ULPDU\ RI3HUVRQDO3HU'HEW 5HYHQXH %RQGV 5HYROYLQJ %RQGV 3D\DEOH %RQGV %RQGV *RYHUQPHQW,QFRPHD&DSLWDD 'HWDLOVUHJDUGLQJWKH&LW\ VRXWVWDQGLQJGHEWPD\EHIRXQGLQWKHQRWHVWRWKHILQDQFLDOVWDWHPHQWV$OOILJXUHVDUHSUHVHQWHGQHWRIUHODWHGSUHPLXPVGLVFRXQWVDQGDGMXVWPHQWVLIDSSOLFDEOHD3RSXODWLRQDQGSHUVRQDOLQFRPHGDWDIURP86&HQVXV%XUHDX0HWURSROLWDQ&RXQFLOIRXQGRQSDJH %XVLQHVV7\SH$FWLYLWLHV<HDU)LVFDO*RYHUQPHQWDO$FWLYLWLHVA-70 &,7<2)(',1$0,11(627$5$7,262)*(1(5$/%21'(''(%728767$1',1*/$677(1),6&$/<($56 '2//$56,17+286$1'6(;&(373(5&$3,7$ *HQHUDO2EOLJDWLRQ /HVV $PRXQWV$YDLODEOH 3HUFHQWDJHRI'HEWDLQ'HEW6HUYLFH)XQGE7RWDO3URSHUW\9DOXHF3HU&DSLWDG 'HWDLOVUHJDUGLQJWKH&LW\ VRXWVWDQGLQJGHEWPD\EHIRXQGLQWKHQRWHVWRWKHILQDQFLDOVWDWHPHQWVD3UHVHQWHGQHWRIUHODWHGSUHPLXPVGLVFRXQWVDQGDGMXVWPHQWVE7KLVLVWKHDPRXQWUHVWULFWHGIRUGHEWVHUYLFHSULQFLSDOSD\PHQWVF6HHVWDWLVWLFDOVFKHGXOHWLWOHG$VVHVVHG9DOXH$FWXDO9DOXHDQG7D[&DSDFLW\RI7D[DEOH3URSHUW\IRUHVWLPDWHGSURSHUW\YDOXHGDWDG3RSXODWLRQIURP86&HQVXV%XUHDX0HWURSROLWDQ&RXQFLOIRXQGRQSDJH <HDU)LVFDO&,7<2)(',1$0,11(627$',5(&7$1'29(5/$33,1**29(510(17$/$&7,9,7,(6'(%7'(&(0%(5 1HW*HQHUDO 3HUFHQWDJH2EOLJDWLRQ%RQGHG $SSOLFDEOH &LW\6KDUH'HEW2XWVWDQGLQJLQ&LW\DRI'HEW2YHUODSSLQJ'HEW +HQQHSLQ&RXQW\ +HQQHSLQ6XEXUEDQ3DUN'LVWULFW+HQQHSLQ5HJLRQDO5DLO$XWKRULW\ 6FKRRO'LVWULFWV ,6'1R (GLQD ,6'1R +RSNLQV ,6'1R %ORRPLQJWRQ ,6'1R (GHQ3UDLULH ,6'1R 5LFKILHOG ,6'1R 6W/RXLV3DUN 0HWUR&RXQFLO 7RWDO2YHUODSSLQJ'HEW &LW\RI(GLQD7RWDO2YHUODSSLQJDQG'LUHFW'HEW 5DWLRRI'HEW3HU&DSLWD 3RSXODWLRQ 5DWLRRI'HEWWR(VWLPDWHG0DUNHW9DOXDWLRQRI 6RXUFH +HQQHSLQ&RXQW\7D[SD\HU6HUYLFHVD7KHSHUFHQWDJHRIRYHUODSSLQJGHEWDSSOLFDEOHLVHVWLPDWHGXVLQJWD[FDSDFLW\$SSOLFDEOHSHUFHQWDJHVZHUHHVWLPDWHGE\GHWHUPLQLQJWKHSRUWLRQRIDQRWKHUJRYHUQPHQWDOXQLW VWD[FDSDFLW\WKDWLVZLWKLQWKH&LW\ VERXQGDULHVDQGGLYLGLQJLWE\HDFKXQLW VWRWDOWD[FDSDFLW\'LUHFW'HEW 'HEW5DWLRV A-71 &,7<2)(',1$0,11(627$/(*$/'(%70$5*,1,1)250$7,21/$677(1),6&$/<($56 '2//$56,17+286$1'6 'HEW/LPLW 7RWDO1HW'HEW$SSOLFDEOHWR/LPLW /HJDO'HEW0DUJLQ 7RWDO1HW'HEW$SSOLFDEOHWRWKH/LPLWDVD3HUFHQWDJHRI'HEW/LPLW 0DUNHW9DOXH $IWHU)LVFDO'LVSDULWLHV 'HEW/LPLW RI0DUNHW9DOXH 'HEW$SSOLFDEOHWR/LPLW *HQHUDO2EOLJDWLRQ%RQGV3XEOLF3URMHFW5HYHQXH%RQGV 7RWDO'HEW$SSOLFDEOHWR/LPLW/HJDO'HEW0DUJLQ/HJDO'HEW0DUJLQ&DOFXODWLRQIRU)LVFDO<HDU)LVFDO<HDU&,7<2)(',1$0,11(627$3/('*('5(9(18(&29(5$*(/$677(1),6&$/<($56 /HVV 2SHUDWLQJ1HW$YDLODEOH5HYHQXH ([SHQVHV 5HYHQXH3ULQFLSDO,QWHUHVW7RWDO&RYHUDJH3XEOLF3URMHFW5HYHQXH%RQGV $QQXDO$SSURSULDWLRQ/HDVH5HYHQXH 7D[,QFUHPHQW%RQGV 3HUPDQHQW,PSURYHPHQW5HYROYLQJ%RQGV 6SHFLDO$VVHVVPHQW 8WLOLW\%RQG 5HFUHDWLRQDO)DFLOLW\%RQGV 'HEW6HUYLFH5HTXLUHPHQWV)LVFDO<HDUA-72 &,7<2)(',1$0,11(627$'(02*5$3+,&$1'(&2120,&67$7,67,&6/$677(1),6&$/<($56 (VWLPDWHG3HUVRQDO 3HU&DSLWD +LJK6FKRRO,QFRPH 3HUVRQDO *UDGXDWLRQ 8QHPSOR\PHQW3RSXODWLRQ ,QWKRXVDQGV ,QFRPH 5DWH 5DWH 6RXUFHV 3RSXODWLRQGDWDIURP86&HQVXV%XUHDX0HWURSROLWDQ&RXQFLOLVWKHPRVWUHFHQW3HUVRQDOLQFRPHDQGSHUFDSLWDLQFRPHHVWLPDWHVEDVHGRQ01'HSDUWPHQWRI(PSOR\PHQWDQG(FRQRPLF'HYHORSPHQW4XDUWHUO\&HQVXVRI(PSOR\PHQWDQG:DJHVLVWKHPRVWUHFHQW+LJKVFKRROJUDGXDWLRQUDWHGDWDIURP86&HQVXV%XUHDXIRUWKH&LW\RI(GLQD8QHPSOR\PHQWUDWHGDWDIURP6WDWHRI0LQQHVRWD'HSDUWPHQWRI(PSOR\PHQWDQG(FRQRPLF'HYHORSPHQW)LVFDO<HDU &,7<2)(',1$0,11(627$35,1&,3$/(03/2<(56&855(17<($5$1'1,1(<($56$*2 3HUFHQWDJH3HUFHQWDJHRI7RWDO&LW\RI7RWDO&LW\(PSOR\HHV 5DQN (PSOR\PHQW (PSOR\HHV 5DQN(PSOR\PHQW(GLQD5HDOW\ '1$ '1$ '1$ '1$&ROGZHOO%DQNHU5HDOW\ '1$ '1$ '1$ '1$)DLUYLHZ6RXWKGDOH+RVSLWDO (GLQD3XEOLF6FKRROV,6' %,:RUOGZLGH &LW\RI(GLQD '1$ '1$ '1$&KLOGUHQ V0LQQHVRWD3HGLDWULF+HDOWK '1$ '1$ '1$'RZ:DWHU 3URFHVV6ROXWLRQV '1$ '1$ '1$/XQG)RRG+ROGLQJV,QF '1$ '1$ '1$:HVWHUQ1DWLRQDO,QVXUDQFH&RPSDQ\ '1$ '1$ '1$0DF\ V 0DUVKDOO)LHOG VRU'D\WRQ V '1$ '1$ '1$ 8QLYHUDO+RVSLWDO6HUYLFHV,QF'1$ '1$ '1$ 3URPHQDGH6DORQ&RQFHSWV'1$ '1$ '1$ 5HJLV6DORQV'LYLVLRQ'1$ '1$ '1$ 5HJLV)UDQFKLVH'LYLVLRQ'1$ '1$ '1$ 0DVWHU&XWV'LYLVLRQ'1$ '1$ '1$ 6PDUW6W\OH)DPLO\+DLU&DUH'1$ '1$ '1$ 7RWDOV6RXUFHV GDWDIURPWKH&LW\$[OH5HIHUHQFH6ROXWLRQVZULWWHQDQGWHOHSKRQHVXUYH\ $SULO GRQHE\(KOHUVDQGWKH0LQQHVRWD'HSDUWPHQWRI(PSOR\PHQWDQG(FRQRPLF'HYHORSPHQWGDWDIURPSUHYLRXV$&)5'1$ 'DWDLVQRWDYDLODEOH(PSOR\HUA-73 &,7<2)(',1$0,11(627$)8//7,0((48,9$/(17&,7<*29(510(17(03/2<((6%<)81&7,21/$677(1),6&$/<($56 EEEEE $GPLQLVWUDWLRQ*HQHUDO)XQG &RPPXQLFDWLRQV*HQHUDO)XQG ,QWHUQDO6HUYLFHV ,QIRUPDWLRQ7HFKQRORJ\6HUYLFHV,QWHUQDO6HUYLFHV &RPPXQLW\'HYHORSPHQW*HQHUDO)XQG +5$)XQG (QJLQHHULQJ*HQHUDO)XQG 3$&6)XQG 8WLOLWLHV)XQG &$6)XQG &RQVWUXFWLRQ)XQG ,QWHUQDO6HUYLFHV )LQDQFH*HQHUDO)XQG 8WLOLWLHV)XQG /LTXRU)XQG )LUH3URWHFWLRQ*HQHUDO)XQG 8WLOLWLHV)XQG +XPDQ5HVRXUFHV*HQHUDO)XQG ,QWHUQDO6HUYLFHV 3DUNV 5HFUHDWLRQ*HQHUDO)XQG $TXDWLF&HQWHU *ROI&RXUVH $UHQD 6SRUWV'RPH $UW&HQWHU (GLQERURXJK3DUN &HQWHQQLDO/DNHV /LTXRU)XQG (QWHUSULVH)XQGV 3ROLFH3URWHFWLRQ*HQHUDO)XQG 3XEOLF:RUNV*HQHUDO)XQG 8WLOLWLHV)XQG ,QWHUQDO6HUYLFHV (QWHUSULVH)XQGV 2WKHU 7RWDO 6RXUFH &LW\RI(GLQD%XGJHWD)XOOWLPHHPSOR\HHFRXQWVGRQRWLQFOXGH&RXQFLOPHPEHUVSDUWWLPHFRQWUDFWRUVHDVRQDOHPSOR\HHV,QDW\SLFDO\HDUWKH&LW\ZLOOHPSOR\DQDGGLWLRQDOSHRSOHLQWKHVHFDWHJRULHVE7KH&LW\FRPSOHWHGGHSDUWPHQWDOUHRUJDQL]DWLRQVWKDWDUHUHIOHFWHGRQWKLVFKDUWEHWZHHQ\HDUVDQG,QVRPHFDVHVGDWDIRU\HDUVEHIRUHWKHUHRUJDQL]DWLRQKDVEHHQPRGLILHGIURPZKDWZDVRULJLQDOO\UHSRUWHGWRLPSURYHFRPSDULVRQV)XQFWLRQ%XGJHWHG)XOO7LPH(PSOR\HHVIRU)LVFDO<HDUD&,7<2)(',1$0,11(627$23(5$7,1*,1',&$7256%<)81&7,21/$677(1),6&$/<($56 *HQHUDO*RYHUQPHQW7RWDO&LW\(PSOR\HHV 9RWHV&DVWD 3XEOLF:RUNV$VSKDOW3ODFHG 7RQV &RQFUHWH FX\GV 3XEOLF6DIHW\)LUH&DOOV 0HGLFDO&DOOV 3ROLFH&DOOVIRU6HUYLFHG ,QWHUQDO6HUYLFHV9HKLFOH)L[HV 8WLOLWLHV'DLO\&RQVXPSWLRQE $TXDWLF&HQWHU$WWHQGDQFH *ROI&RXUVH7RWDO5RXQGV3OD\HGF 6RXUFH 9DULRXV&LW\GHSDUWPHQWV1'DWDQRWDYDLODEOHD7KH&LW\HOHFWLRQVGHSDUWPHQWUXQVJHQHUDOHOHFWLRQVLQHYHQQXPEHUHG\HDUVDQGVFKRROGLVWULFWHOHFWLRQVLQRGGQXPEHUHG\HDUV1XPEHURIYRWHVFDVWWHQGWRYDU\EHWZHHQHYHQDQGRGGQXPEHUHG\HDUVDQGEDVHGRQSUHVLGHQWLDOHOHFWLRQF\FOHVE'DLO\DYHUDJHRIZDWHUSXPSHGIURPFLW\ZHOOVPHDVXUHGLQWKRXVDQGVRIJDOORQVFKROHJROIFRXUVHZDVFORVHGDQGUHFRQVWUXFWHGLQWRDQKROHFKDPSLRQVKLSFRXUVHIURPG&KDQJHGIURP&ULPHVUHSRUWHGWRSURYLGHIXOOGDWDRISROLFHVHUYLFHFDOOV)XQFWLRQ)LVFDO<HDUA-74 &,7<2)(',1$0,11(627$&$3,7$/$66(767$7,67,&6%<)81&7,21/$677(1),6&$/<($56 3XEOLF:RUNV0LOHVRI6WUHHWV &LW\3DUNLQJ5DPSV 3XEOLF6DIHW\)LUH6WDWLRQV 3DUNVDQG5HFUHDWLRQ&LW\3DUNV $FUHDJHRI3DUNV 3DUN%XLOGLQJV 8WLOLWLHV:HOOV :DWHUPDLQ0LOHV 6DQLWDU\6HZHU0LOHV 6HZHU&RQQHFWLRQV $UHQD,FH6KHHWV 6RXUFH 9DULRXV&LW\GHSDUWPHQWV)XQFWLRQ)LVFDO<HDUA-75 APPENDIX B FORM OF LEGAL OPINION (See following pages) B-1 Form of Bond Counsel Opinion City of Edina Edina, Minnesota [Purchaser] [City, State] Re: $[PAR] General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B City of Edina, Hennepin County, Minnesota Ladies and Gentlemen: As Bond Counsel in connection with the authorization, issuance and sale by the City of Edina, Minnesota (the “City”), of its General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B dated, as originally issued, as of August [__], 2022, in the total principal amount of $[PAR] (the “Bonds”), we have examined certified copies of certain proceedings taken, and certain affidavits and certificates furnished, by the City in the authorization, sale and issuance of the Bonds, including the form of the Bonds. As to questions of fact material to our opinion we have assumed the authenticity of and relied upon the proceedings, affidavits and certificates furnished to us without undertaking to verify the same by independent investigation. From our examination of such proceedings, affidavits and certificates, and based upon laws, regulations, rulings and decisions in effect on the date hereof, it is our opinion that: 1.The Bonds are valid and binding general obligations of the City enforceable in accordance with their terms. 2. The principal of and interest on the Bonds are payable from additional temporary bonds or definitive bonds and ad valorem taxes to be levied on all taxable property in the City, which bond proceeds and taxes are expected to produce amounts sufficient to pay the principal and interest on the Bonds when due; but, if necessary for the payment of such principal and interest, additional ad valorem taxes are required by law to be levied on all taxable property in the City without limitation as to rate or amount. 3.Interest on the Bonds (a) is excluded from gross income for federal income tax purposes under Section 103 of the Internal Revenue Code of 1986 (the “Code”) and (b) is not an item of tax preference for purposes of the federal alternative minimum tax imposed by Section 55 of the Code. 4. Interest on the Bonds (a) is excluded from taxable net income of individuals, estates, and trusts for Minnesota income tax purposes and (b) is not an item of tax preference for purposes of the Minnesota alternative minimum tax imposed on individuals, trusts, and estates. The opinions expressed in paragraphs 1 and 2 above are subject, as to enforceability, to the effect of any state or federal laws relating to bankruptcy, insolvency, reorganization, moratorium or creditors’ rights and the application of equitable principles, whether considered at law or in equity. The opinions expressed in paragraphs 3 and 4 above are subject to the compliance by the Issuer with certain requirements of the Code that must be satisfied subsequent to the issuance of the Bonds. Noncompliance with these requirements could result in the inclusion of interest on the Bonds in gross income for federal income tax purposes and taxable net income of individuals, estates, and trusts for Minnesota income tax purposes, retroactive to the date of issuance of the Bonds. B-2 City of Edina [Purchaser] Page 2 Except as stated herein, we express no opinion regarding federal, state, or other tax consequences to the owner of the Bonds. We note, however, that notwithstanding the opinion expressed in paragraph 4 above, interest on the Bonds is included in net income of corporations and financial institutions for purposes of the Minnesota franchise tax. In providing this opinion, we have relied upon representations of the City and its officers as to (i) the intended application of the proceeds of the Bonds, (ii) the nature, use, cost, and economic life of the facilities and equipment financed by the Bonds, and (iii) other matters relating to the exemption of the interest on the Bonds from federal income taxation. This opinion is given as of the date hereof, and we assume no obligation to revise or supplement this opinion to reflect any facts or circumstances that may hereafter come to our attention or any changes in law that may occur after the date hereof and which may be retroactive. Dated: August [__], 2022. Very truly yours, B-3 APPENDIX C BOOK-ENTRY-ONLY SYSTEM 1.The Depository Trust Company ("DTC"), New York, New York, will act as securities depository for the securities (the "Securities"). The Securities will be issued as fully-registered securities registered in the name of Cede & Co. (DTC's partnership nominee) or such other name as may be requested by an authorized representative of DTC. One fully-registered Security certificate will be issued for [each issue of] the Securities, [each] in the aggregate principal amount of such issue, and will be deposited with DTC. [If, however, the aggregate principal amount of [any] issue exceeds $500 million, one certificate will be issued with respect to each $500 million of principal amount, and an additional certificate will be issued with respect to any remaining principal amount of such issue.] 2. DTC, the world's largest securities depository, is a limited-purpose trust company organized under the New York Banking Law, a "banking organization" within the meaning of the New York Banking Law, a member of the Federal Reserve System, a "clearing corporation" within the meaning of the New York Uniform Commercial Code, and a "clearing agency" registered pursuant to the provisions of Section 17A of the Securities Exchange Act of 1934. DTC holds and provides asset servicing for over 3.5 million issues of U.S. and non-U.S. equity issues, corporate and municipal debt issues, and money market instruments (from over 100 countries) that DTC's participants ("Direct Participants") deposit with DTC. DTC also facilitates the post-trade settlement among Direct Participants of sales and other securities transactions in deposited securities, through electronic computerized book-entry transfers and pledges between Direct Participants' accounts. This eliminates the need for physical movement of securities certificates. Direct Participants include both U.S. and non-U.S. securities brokers and dealers, banks, trust companies, clearing corporations, and certain other organizations. DTC is a wholly-owned subsidiary of The Depository Trust & Clearing Corporation ("DTCC"). DTCC is the holding company for DTC, National Securities Clearing Corporation and Fixed Income Clearing Corporation, all of which are registered clearing agencies. DTCC is owned by the users of its regulated subsidiaries. Access to the DTC system is also available to others such as both U.S. and non-U.S. securities brokers and dealers, banks, trust companies, and clearing corporations that clear through or maintain a custodial relationship with a Direct Participant, either directly or indirectly ("Indirect Participants"). DTC has a Standard & Poor's rating of AA+. The DTC Rules applicable to its Participants are on file with the Securities and Exchange Commission. More information about DTC can be found at www.dtcc.com. 3. Purchases of Securities under the DTC system must be made by or through Direct Participants, which will receive a credit for the Securities on DTC's records. The ownership interest of each actual purchaser of each Security ("Beneficial Owner") is in turn to be recorded on the Direct and Indirect Participants' records. Beneficial Owners will not receive written confirmation from DTC of their purchase. Beneficial Owners are, however, expected to receive written confirmations providing details of the transaction, as well as periodic statements of their holdings, from the Direct or Indirect Participant through which the Beneficial Owner entered into the transaction. Transfers of ownership interests in the Securities are to be accomplished by entries made on the books of Direct and Indirect Participants acting on behalf of Beneficial Owners. Beneficial Owners will not receive certificates representing their ownership interests in Securities, except in the event that use of the book-entry system for the Securities is discontinued. 4. To facilitate subsequent transfers, all Securities deposited by Direct Participants with DTC are registered in the name of DTC's partnership nominee, Cede & Co., or such other name as may be requested by an authorized representative of DTC. The deposit of Securities with DTC and their registration in the name of Cede & Co. or such other DTC nominee do not effect any change in beneficial ownership. DTC has no knowledge of the actual Beneficial Owners of the Securities; DTC's records reflect only the identity of the Direct Participants to whose accounts such Securities are credited, which may or may not be the Beneficial Owners. The Direct and Indirect Participants will remain responsible for keeping account of their holdings on behalf of their customers. C-1 5. Conveyance of notices and other communications by DTC to Direct Participants, by Direct Participants to Indirect Participants, and by Direct Participants and Indirect Participants to Beneficial Owners will be governed by arrangements among them, subject to any statutory or regulatory requirements as may be in effect from time to time. [Beneficial Owners of Securities may wish to take certain steps to augment the transmission to them of notices of significant events with respect to the Securities, such as redemptions, tenders, defaults, and proposed amendments to the Security documents. For example, Beneficial Owners of Securities may wish to ascertain that the nominee holding the Securities for their benefit has agreed to obtain and transmit notices to Beneficial Owners. In the alternative, Beneficial Owners may wish to provide their names and addresses to the registrar and request that copies of notices be provided directly to them.] 6. Redemption notices shall be sent to DTC. If less than all of the Securities within an issue are being redeemed, DTC's practice is to determine by lot the amount of the interest of each Direct Participant in such issue to be redeemed. 7. Neither DTC nor Cede & Co. (nor any other DTC nominee) will consent or vote with respect to Securities unless authorized by a Direct Participant in accordance with DTC's MMI Procedures. Under its usual procedures, DTC mails an Omnibus Proxy to City as soon as possible after the record date. The Omnibus Proxy assigns Cede & Co.'s consenting or voting rights to those Direct Participants to whose accounts Securities are credited on the record date (identified in a listing attached to the Omnibus Proxy). 8. Redemption proceeds, distributions, and dividend payments on the Securities will be made to Cede & Co., or such other nominee as may be requested by an authorized representative of DTC. DTC's practice is to credit Direct Participants' accounts upon DTC's receipt of funds and corresponding detail information from the City or Agent, on payable date in accordance with their respective holdings shown on DTC's records. Payments by Participants to Beneficial Owners will be governed by standing instructions and customary practices, as is the case with securities held for the accounts of customers in bearer form or registered in "street name," and will be the responsibility of such Participant and not of DTC, Agent, or the City, subject to any statutory or regulatory requirements as may be in effect from time to time. Payment of redemption proceeds, distributions, and dividend payments to Cede & Co. (or such other nominee as may be requested by an authorized representative of DTC) is the responsibility of the City or Agent, disbursement of such payments to Direct Participants will be the responsibility of DTC, and disbursement of such payments to the Beneficial Owners will be the responsibility of Direct and Indirect Participants. 9. A Beneficial Owner shall give notice to elect to have its Securities purchased or tendered, through its Participant, to [Tender/Remarketing] Agent, and shall effect delivery of such Securities by causing the Direct Participant to transfer the Participant's interest in the Securities, on DTC's records, to [Tender/Remarketing] Agent. The requirement for physical delivery of Securities in connection with an optional tender or a mandatory purchase will be deemed satisfied when the ownership rights in the Securities are transferred by Direct Participants on DTC's records and followed by a book-entry credit of tendered Securities to [Tender/Remarketing] Agent's DTC account. 10.DTC may discontinue providing its services as depository with respect to the Securities at any time by giving reasonable notice to the City or Agent. Under such circumstances, in the event that a successor depository is not obtained, Security certificates are required to be printed and delivered. 11.The City may decide to discontinue use of the system of book-entry-only transfers through DTC (or a successor securities depository). In that event, Security certificates will be printed and delivered to DTC. 12.The information in this section concerning DTC and DTC's book-entry system has been obtained from sources that the City believes to be reliable, but the City takes no responsibility for the accuracy thereof. C-2 APPENDIX D FORM OF CONTINUING DISCLOSURE COVENANTS (EXCERPTS FROM SALE RESOLUTION) (See following pages) D-1 4854-5594-0647\1 APPENDIX D CONTINUING DISCLOSURE COVENANTS Continuing Disclosure. (a) Purpose and Beneficiaries. To provide for the public availability of certain information relating to the Bonds and the security therefor and to permit the Purchaser and other participating underwriters in the primary offering of the Bonds to comply with amendments to Rule 15c2- 12 promulgated by the SEC under the Securities Exchange Act of 1934 (17 C.F.R. § 240.15c2-12), relating to continuing disclosure (as in effect and interpreted from time to time, the Rule), which will enhance the marketability of the Bonds, the City hereby makes the following covenants and agreements for the benefit of the Owners (as hereinafter defined) from time to time of the Outstanding Bonds. The City is the only obligated person in respect of the Bonds within the meaning of the Rule for purposes of identifying the entities in respect of which continuing disclosure must be made. If the City fails to comply with any provisions of this section, any person aggrieved thereby, including the Owners of any Outstanding Bonds, may take whatever action at law or in equity may appear necessary or appropriate to enforce performance and observance of any agreement or covenant contained in this section, including an action for a writ of mandamus or specific performance. Direct, indirect, consequential and punitive damages shall not be recoverable for any default hereunder to the extent permitted by law. Notwithstanding anything to the contrary contained herein, in no event shall a default under this section constitute a default under the Bonds or under any other provision of this resolution. As used in this section, Owner or Bondowner means, in respect of a Bond, the registered owner or owners thereof appearing in the bond register maintained by the Registrar or any Beneficial Owner (as hereinafter defined) thereof, if such Beneficial Owner provides to the Registrar evidence of such beneficial ownership in form and substance reasonably satisfactory to the Registrar. As used herein, Beneficial Owner means, in respect of a Bond, any person or entity which (i) has the power, directly or indirectly, to vote or consent with respect to, or to dispose of ownership of, such Bond (including persons or entities holding Bonds through nominees, depositories or other intermediaries), or (ii) is treated as the owner of the Bond for federal income tax purposes. (b) Information To Be Disclosed. The City will provide, in the manner set forth in subsection (c) hereof, either directly or indirectly through an agent designated by the City, the following information at the following times: (1)on or before twelve months after the end of each fiscal year of the City, commencing with the fiscal year ending December 31, 2022, the following financial information and operating data in respect of the City (the Disclosure Information): (A)the audited financial statements of the City for such fiscal year, prepared in accordance with the governmental accounting standards promulgated by the Governmental Accounting Standards Board or as otherwise provided under Minnesota law, as in effect from time to time, or, if and to the extent such financial statements have not been prepared in accordance with such generally accepted accounting principles for reasons beyond the reasonable control of the City, noting the discrepancies therefrom and the effect thereof, and certified as to accuracy and completeness in all material respects by the fiscal officer of the City; and (B)to the extent not included in the financial statements referred to in paragraph (A) hereof, the information for such fiscal year or for the period most recently available of the type contained in the Official Statement under headings: “VALUATIONS—Current Property Valuations,” “DEBT—Direct Debt,” and D-2 4854-5594-0647\1 “TAX RATES, LEVIES AND COLLECTIONS—Tax Levies and Collections” and “GENERAL INFORMATION—US Census Data—Population Trend” and “—Employment / Unemployment Data,” which information may be unaudited. Notwithstanding the foregoing paragraph, if the audited financial statements are not available by the date specified, the City shall provide on or before such date unaudited financial statements in the format required for the audited financial statements as part of the Disclosure Information and, within 10 days after the receipt thereof, the City shall provide the audited financial statements. Any or all of the Disclosure Information may be incorporated by reference, if it is updated as required hereby, from other documents, including official statements, which have been filed with the SEC or have been made available to the public on the Internet Web site of the Municipal Securities Rulemaking Board (MSRB. If the document incorporated by reference is a final official statement, it must be available from the MSRB. The City shall clearly identify in the Disclosure Information each document so incorporated by reference. If any part of the Disclosure Information can no longer be generated because the operations of the City have materially changed or been discontinued, such Disclosure Information need no longer be provided if the City includes in the Disclosure Information a statement to such effect; provided, however, if such operations have been replaced by other City operations in respect of which data is not included in the Disclosure Information and the City determines that certain specified data regarding such replacement operations would be a Material Fact (as defined in paragraph (2) hereof), then, from and after such determination, the Disclosure Information shall include such additional specified data regarding the replacement operations. If the Disclosure Information is changed or this section is amended as permitted by this paragraph (b)(1) or subsection (d), then the City shall include in the next Disclosure Information to be delivered hereunder, to the extent necessary, an explanation of the reasons for the amendment and the effect of any change in the type of financial information or operating data provided. (2) In a timely manner not in excess of ten business days after the occurrence of the event, notice of the occurrence of any of the following events (each a Material Fact): (A) Principal and interest payment delinquencies; (B) Non-payment related defaults, if material; (C) Unscheduled draws on debt service reserves reflecting financial difficulties; (D) Unscheduled draws on credit enhancements reflecting financial difficulties; (E) Substitution of credit or liquidity providers, or their failure to perform; (F) Adverse tax opinions, the issuance by the Internal Revenue Service of proposed or final determinations of taxability, Notices of Proposed Issue (IRS Form 5701- TEB) or other material notices or determinations with respect to the tax status of the security, or other material events affecting the tax status of the security; (G) Modifications to rights of security holders, if material; (H) Bond calls, if material, and tender offers; (I) Defeasances; (J) Release, substitution, or sale of property securing repayment of the securities, if material; (K) Rating changes; (L) Bankruptcy, insolvency, receivership or similar event of the obligated person; (M) The consummation of a merger, consolidation, or acquisition involving an obligated person or the sale of all or substantially all of the assets of the obligated person, other than in the ordinary course of business, the entry into a definitive agreement to undertake such an action or the termination of a definitive agreement relating to any such actions, other than pursuant to its terms, if material; D-3 4854-5594-0647\1 (N) Appointment of a successor or additional trustee or the change of name of a trustee, if material; (O) Incurrence of a financial obligation of the obligated person, if material, or agreement to covenants, events of default, remedies, priority rights, or other similar terms of a financial obligation of the obligated person, any of which affect security holders, if material; and (P) Default, event of acceleration, termination event, modification of terms, or other similar events under the terms of a financial obligation of the obligated person, any of which reflect financial difficulties. For purposes of the events identified in paragraphs (O) and (P) above, the term “financial obligation” means (i) a debt obligation; (ii) a derivative instrument entered into in connection with, or pledged as security or a source of payment for, an existing or planned debt obligation; or (iii) a guarantee of (i) or (ii). The term “financial obligation” shall not include municipal securities as to which a final official statement has been provided to the MSRB consistent with the Rule. As used herein, for those events that must be reported if material, an event is “material” if it is an event as to which a substantial likelihood exists that a reasonably prudent investor would attach importance thereto in deciding to buy, hold or sell a Bond or, if not disclosed, would significantly alter the total information otherwise available to an investor from the Official Statement, information disclosed hereunder or information generally available to the public. Notwithstanding the foregoing sentence, an event is also “material” if it is an event that would be deemed material for purposes of the purchase, holding or sale of a Bond within the meaning of applicable federal securities laws, as interpreted at the time of discovery of the occurrence of the event. For the purposes of the event identified in (L) hereinabove, the event is considered to occur when any of the following occur: the appointment of a receiver, fiscal agent or similar officer for an obligated person in a proceeding under the U.S. Bankruptcy Code or in any other proceeding under state or federal law in which a court or governmental authority has assumed jurisdiction over substantially all of the assets or business of the obligated person, or if such jurisdiction has been assumed by leaving the existing governing body and officials or officers in possession but subject to the supervision and orders of a court or governmental authority, or the entry of an order confirming a plan of reorganization, arrangement or liquidation by a court or governmental authority having supervision or jurisdiction over substantially all of the assets or business of the obligated person. (3) In a timely manner, notice of the occurrence of any of the following events or conditions: (A) the failure of the City to provide the Disclosure Information required under paragraph (b)(1) at the time specified thereunder; (B) the amendment or supplementing of this section pursuant to subsection (d), together with a copy of such amendment or supplement and any explanation provided by the City under subsection (d)(2); (C) the termination of the obligations of the City under this section pursuant to subsection (d); (D) any change in the accounting principles pursuant to which the financial statements constituting a portion of the Disclosure Information are prepared; and (E) any change in the fiscal year of the City. (c) Manner of Disclosure. D-4 4854-5594-0647\1 (1) The City agrees to make available to the MSRB, in an electronic format as prescribed by the MSRB from time to time, the information described in subsection (b). (2) All documents provided to the MSRB pursuant to this subsection (c) shall be accompanied by identifying information as prescribed by the MSRB from time to time. (d) Term; Amendments; Interpretation. (1) The covenants of the City in this section shall remain in effect so long as any Bonds are Outstanding. Notwithstanding the preceding sentence, however, the obligations of the City under this section shall terminate and be without further effect as of any date on which the City delivers to the Registrar an opinion of Bond Counsel to the effect that, because of legislative action or final judicial or administrative actions or proceedings, the failure of the City to comply with the requirements of this section will not cause participating underwriters in the primary offering of the Bonds to be in violation of the Rule or other applicable requirements of the Securities Exchange Act of 1934, as amended, or any statutes or laws successory thereto or amendatory thereof. (2) This section (and the form and requirements of the Disclosure Information) may be amended or supplemented by the City from time to time, without notice to (except as provided in paragraph (c)(3) hereof) or the consent of the Owners of any Bonds, by a resolution of this Council filed in the office of the recording officer of the City accompanied by an opinion of Bond Counsel, who may rely on certificates of the City and others and the opinion may be subject to customary qualifications, to the effect that: (i) such amendment or supplement (a) is made in connection with a change in circumstances that arises from a change in law or regulation or a change in the identity, nature or status of the City or the type of operations conducted by the City, or (b) is required by, or better complies with, the provisions of paragraph (b)(5) of the Rule; (ii) this section as so amended or supplemented would have complied with the requirements of paragraph (b)(5) of the Rule at the time of the primary offering of the Bonds, giving effect to any change in circumstances applicable under clause (i)(a) and assuming that the Rule as in effect and interpreted at the time of the amendment or supplement was in effect at the time of the primary offering; and (iii) such amendment or supplement does not materially impair the interests of the Bondowners under the Rule. If the Disclosure Information is so amended, the City agrees to provide, contemporaneously with the effectiveness of such amendment, an explanation of the reasons for the amendment and the effect, if any, of the change in the type of financial information or operating data being provided hereunder. (3) This section is entered into to comply with the continuing disclosure provisions of the Rule and should be construed so as to satisfy the requirements of paragraph (b)(5) of the Rule. D-5 APPENDIX E TERMS OF PROPOSAL $17,000,000* GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B CITY OF EDINA, MINNESOTA Proposals for the purchase of $17,000,000* General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B (the "Bonds") of the City of Edina, Minnesota (the "City") will be received at the offices of Ehlers and Associates, Inc. ("Ehlers"), 3060 Centre Pointe Drive, Roseville, Minnesota 55113-1105, municipal advisors to the City, until 10:00 A.M., Central Time, and ELECTRONIC PROPOSALS will be received via PARITY, in the manner described below, until 10:00 A.M. Central Time, on August 3, 2022, at which time they will be opened, read and tabulated. The proposals will be presented to the City Council for consideration for award by resolution at a meeting to be held at 7:00 P.M., Central Time, on the same date. The proposal offering to purchase the Bonds upon the terms specified herein and most favorable to the City will be accepted unless all proposals are rejected. PURPOSE The Bonds are being issued pursuant to Minnesota Statutes, Sections 475.521 and 475.61, and Chapter 475, as amended, by the City, for the purpose of financing the site acquisition and design for the City's Fire Station No. 2 project. The Bonds are general obligations of the City, for which its full faith, credit and taxing powers are pledged. DATES AND MATURITIES The Bonds will be dated August 25, 2022, will be issued as fully registered Bonds in the denomination of $5,000 each, or any integral multiple thereof, and will mature on February 1 as follows: Year Amount* 2025 $17,000,000 ADJUSTMENT OPTION * The City reserves the right to increase or decrease the principal amount of the Bonds on the day of sale, in increments of $5,000 each. Increases or decreases may be made in any maturity. If any principal amounts are adjusted, the purchase price proposed will be adjusted to maintain the same gross spread per $1,000. INTEREST PAYMENT DATES AND RATES The Bonds will be dated originally as of August 25, 2022, will be issued in fully registered form in the denomination of $5,000 each, or any integral multiple thereof, and will mature on February 1, 2025. The Bonds will bear interest at a single rate specified in the proposal of the purchaser, payable on the date of maturity to the registered owners of the Bonds appearing of record in the bond register as of the close of business fifteen days prior to the maturity date (whether or not a business day). The rate must be expressed in an integral multiple of 5/100 or 1/8 of 1%. Interest will be computed upon the basis of a 360-day year of twelve 30-day months and will be rounded pursuant to rules of the Municipal Securities Rulemaking Board ("MSRB"). E-1 BOOK-ENTRY-ONLY FORMAT Unless otherwise specified by the purchaser, the Bonds will be designated in the name of Cede & Co., as nominee for The Depository Trust Company, New York, New York ("DTC"). DTC will act as securities depository for the Bonds, and will be responsible for maintaining a book-entry system for recording the interests of its participants and the transfers of interests between its participants. The participants will be responsible for maintaining records regarding the beneficial interests of the individual purchasers of the Bonds. So long as Cede & Co. is the registered owner of the Bonds, all payments of principal and interest will be made to the depository which, in turn, will be obligated to remit such payments to its participants for subsequent disbursement to the beneficial owners of the Bonds. PAYING AGENT The City has selected U.S. Bank Trust Company, National Association, St. Paul, Minnesota, to act as paying agent (the "Paying Agent"). The City will pay the charges for Paying Agent services. The City reserves the right to remove the Paying Agent and to appoint a successor. OPTIONAL REDEMPTION At the option of the City, the Bonds maturing on or after February 1, 2025 shall be subject to optional redemption prior to maturity on February 1, 2024 or any date thereafter, at a price of par plus accrued interest to the date of optional redemption. Redemption may be in whole or in part of the Bonds subject to prepayment. If redemption is in part, the selection of the amounts and maturities of the Bonds to be redeemed shall be at the discretion of the City. If only part of the Bonds having a common maturity date are called for redemption, then the City or Paying Agent, if any, will notify DTC of the particular amount of such maturity to be redeemed. DTC will determine by lot the amount of each participant's interest in such maturity to be redeemed and each participant will then select by lot the beneficial ownership interest in such maturity to be redeemed. Notice of redemption shall be sent by mail not more than 60 days and not less than 30 days prior to the date fixed for redemption to the registered owner of each Bond to be redeemed at the address shown on the registration books. DELIVERY On or about August 25, 2022, the Bonds will be delivered without cost to the winning bidder at DTC. On the day of closing, the City will furnish to the winning bidder the opinion of bond counsel hereinafter described, an arbitrage certification, and certificates verifying that no litigation in any manner questioning the validity of the Bonds is then pending or, to the best knowledge of officers of the City, threatened. Payment for the Bonds must be received by the City at its designated depository on the date of closing in immediately available funds. LEGAL OPINION An opinion in substantially the form attached hereto as Appendix B will be furnished by Dorsey & Whitney LLP ("Bond Counsel"), Minneapolis, Minnesota, bond counsel to the City. E-2 SUBMISSION OF PROPOSALS Proposals must not be for less than $16,915,000 plus accrued interest on the principal sum of $17,000,000 from date of original issue of the Bonds to date of delivery. Prior to the time established above for the opening of proposals, interested parties may submit a proposal as follows: 1)Electronically to bondsale@ehlers-inc.com; or 2) Electronically via PARITY in accordance with this Terms of Proposal until 10:00 A.M. Central Time, but no proposal will be received after the time for receiving proposals specified above. To the extent any instructions or directions set forth in PARITY conflict with this Terms of Proposal, the terms of this Terms of Proposal shall control. For further information about PARITY, potential bidders may contact Ehlers or i-Deal LLC at 1359 Broadway, 2nd Floor, New York, New York 10018, Telephone (212) 849-5021. Proposals must be submitted to Ehlers via one of the methods described above and must be received prior to the time established above for the opening of proposals. Each proposal must be unconditional except as to legality. Neither the City nor Ehlers shall be responsible for any failure to receive a facsimile submission. A good faith deposit ("Deposit") in the amount of $340,000 shall be made by the winning bidder by wire transfer of funds. Such Deposit shall be received by Ehlers no later than two hours after the proposal opening time. Wire transfer instructions will be provided to the winning bidder by Ehlers after the tabulation of proposals. The City reserves the right to award the Bonds to a winning bidder whose wire transfer is initiated but not received by such time provided that such winning bidder’s federal wire reference number has been received by such time. In the event the Deposit is not received as provided above, the City may award the Bonds to the bidder submitting the next best proposal provided such bidder agrees to such award. The Deposit will be retained by the City as liquidated damages if the proposal is accepted and the Purchaser fails to comply therewith. The City and the winning bidder who chooses to so wire the Deposit hereby agree irrevocably that Ehlers shall be the escrow holder of the Deposit wired to such account subject only to these conditions and duties: 1) All income earned thereon shall be retained by the escrow holder as payment for its expenses; 2) If the proposal is not accepted, Ehlers shall, at its expense, promptly return the Deposit amount to the winning bidder; 3) If the proposal is accepted, the Deposit shall be returned to the winning bidder at the closing; 4) Ehlers shall bear all costs of maintaining the escrow account and returning the funds to the winning bidder; 5) Ehlers shall not be an insurer of the Deposit amount and shall have no liability hereunder except if it willfully fails to perform or recklessly disregards, its duties specified herein; and 6) FDIC insurance on deposits within the escrow account shall be limited to $250,000 per bidder. No proposal can be withdrawn after the time set for receiving proposals unless the meeting of the City scheduled for award of the Bonds is adjourned, recessed, or continued to another date without award of the Bonds having been made. AWARD The Bonds will be awarded to the bidder offering the lowest interest rate to be determined on a True Interest Cost (TIC) basis. The City’s computation of the interest rate of each proposal, in accordance with customary practice, will be controlling. In the event of a tie, the sale of the Bonds will be awarded by lot. The City reserves the right to reject any and all proposals and to waive any informality in any proposal. E-3 BOND INSURANCE If the Bonds are qualified for any bond insurance policy, the purchase of such policy shall be at the sole option and expense of the winning bidder. Any cost for such insurance policy is to be paid by the winning bidder, except that, if the City requested and received a rating on the Bonds from a rating agency, the City will pay that rating fee. Any rating agency fees not requested by the City are the responsibility of the winning bidder. Failure of the municipal bond insurer to issue the policy after the Bonds are awarded to the winning bidder shall not constitute cause for failure or refusal by the winning bidder to accept delivery of the Bonds. CUSIP NUMBERS The City will assume no obligation for the assignment or printing of CUSIP numbers on the Bonds or for the correctness of any numbers printed thereon, but will permit such numbers to be printed at the expense of the winning bidder, if the winning bidder waives any delay in delivery occasioned thereby. NON-QUALIFIED TAX-EXEMPT OBLIGATIONS The City will NOT designate the Bonds as "qualified tax-exempt obligations" pursuant to Section 265 of the Internal Revenue Code of 1986, as amended, which permits financial institutions to deduct interest expenses allocable to the Bonds to the extent permitted under prior law. CONTINUING DISCLOSURE In order to assist the Underwriters in complying with the provisions of Rule 15c2-12 promulgated by the Securities and Exchange Commission under the Securities Exchange Act of 1934 the City will enter into an undertaking for the benefit of the holders of the Bonds. A description of the details and terms of the undertaking is set forth in Appendix D of the Preliminary Official Statement. NEW ISSUE PRICING The winning bidder will be required to provide, in a timely manner, certain information necessary to compute the yield on the Bonds pursuant to the provisions of the Internal Revenue Code of 1986, as amended, and to provide a certificate which will be provided by Bond Counsel upon request. ESTABLISHMENT OF ISSUE PRICE AT TIME OF AWARD In order to establish the issue price of the Bonds for federal income tax purposes, the City requires bidders to agree to the following, and by submitting a proposal, each bidder agrees to the following. If a proposal is submitted by a potential underwriter, the bidder confirms that (i) the underwriters have offered or reasonably expect to offer the Bonds to the public on or before the date of the award at the offering price (the "initial offering price") for each maturity as set forth in the proposal and (ii) the bidder, if it is the winning bidder, shall require any agreement among underwriters, selling group agreement, retail distribution agreement or other agreement relating to the initial sale of the Bonds to the public to which it is a party to include provisions requiring compliance by all parties to such agreements with the provisions contained herein. For purposes hereof, Bonds with a separate CUSIP number constitute a separate "maturity", and the public does not include underwriters (including members of a selling group or retail distribution group) or persons related to underwriters. If, however, a proposal is submitted for the bidder's own account in a capacity other than as an underwriter of the Bonds, and the bidder has no current intention to sell, reoffer, or otherwise dispose of the Bonds, the bidder shall notify the City to that effect at the time it submits its proposal and shall provide a certificate to that effect in place of the certificate otherwise required below. E-4 If the winning bidder intends to act as an underwriter, the City shall advise the winning bidder at or prior to the time of award whether (i) the competitive sale rule or (ii) the "hold-the-offering price" rule applies. If the City advises the Purchaser that the requirements for a competitive sale have been satisfied and that the competitive sale rule applies, the Purchaser will be required to deliver to the City at or prior to closing a certification, in a form reasonably acceptable to bond counsel, as to the reasonably expected initial offering price as of the award date. If the City advises the Purchaser that the requirements for a competitive sale have not been satisfied and that the hold- the-offering price rule applies, the Purchaser shall (1) upon the request of the City confirm that the underwriters did not offer or sell any maturity of the Bonds to any person at a price higher than the initial offering price of that maturity during the period starting on the award date and ending on the earlier of (a) the close of the fifth business day after the sale date or (b) the date on which the underwriters have sold at least 10% of that maturity to the public at or below the initial offering price; and (2) at or prior to closing, deliver to the City a certification as to such matters, in a form reasonably acceptable to bond counsel, together with a copy of the pricing wire. Any action taken or documentation to be received by the City pursuant hereto may be taken or received on behalf of the City by Ehlers & Associates, Inc. Bidders should prepare their proposals on the assumption that the Bonds will be subject to the "hold-the- offering-price" rule. Any proposal submitted pursuant to the Terms of Proposal shall be considered a firm offer for the purchase of the Bonds, and Bonds submitted will not be subject to cancellation or withdrawal. PRELIMINARY OFFICIAL STATEMENT Bidders may obtain a copy of the Preliminary Official Statement relating to the Bonds prior to the proposal opening by request from Ehlers at www.ehlers-inc.com by connecting to the Bond Sales link. The Syndicate Manager will be provided with an electronic copy of the Final Official Statement within seven business days of the proposal acceptance. Up to 10 printed copies of the Final Official Statement will be provided upon request. Additional copies of the Final Official Statement will be available at a cost of $10.00 per copy. Information for bidders and proposal forms may be obtained from Ehlers at 3060 Centre Pointe Drive, Roseville, Minnesota 55113-1105, Telephone (651) 697-8500. By Order of the City Council City of Edina, Minnesota E-5 PROPOSAL FORM The City Council August 3, 2022 City of Edina, Minnesota (the "City") RE:$17,000,000* General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B (the "Bonds") DATED:August 25, 2022 For all or none of the above Bonds, in accordance with the Terms of Proposal and terms of the Global Book-Entry System (unless otherwise specified by the Purchaser) as stated in this Official Statement, we will pay you $__________________ (not less than $16,915,000) plus accrued interest to date of delivery for fully registered Bonds bearing interest rate and on February 1 in the stated year as follows: % due 2025 * The City reserves the right to increase or decrease the principal amount of the Bonds on the day of sale, in increments of $5,000 each. Increases or decreases may be made in any maturity. If any principal amounts are adjusted, the purchase price proposed will be adjusted to maintain the same gross spread per $1,000. All Bonds of the same maturity must bear interest from date of issue until paid at a single, uniform rate. Each rate must be expressed in an integral multiple of 5/100 or 1/8 of 1%. A good faith deposit ("Deposit") in the amount of $340,000 shall be made by the winning bidder by wire transfer of funds. Such Deposit shall be received by Ehlers no later than two hours after the proposal opening time. Wire transfer instructions will be provided to the winning bidder by Ehlers after the tabulation of proposals. The City reserves the right to award the Bonds to a winning bidder whose wire transfer is initiated but not received by such time provided that such winning bidder’s federal wire reference number has been received by such time. In the event the Deposit is not received as provided above, the City may award the Bonds to the bidder submitting the next best proposal provided such bidder agrees to such award. The Deposit will be retained by the City as liquidated damages if the proposal is accepted and the Purchaser fails to comply therewith. We agree to the conditions and duties of Ehlers and Associates, Inc., as escrow holder of the Deposit, pursuant to the Terms of Proposal. This proposal is for prompt acceptance and is conditional upon delivery of said Bonds to The Depository Trust Company, New York, New York, in accordance with the Terms of Proposal. Delivery is anticipated to be on or about August 25, 2022. This proposal is subject to the City’s agreement to enter into a written undertaking to provide continuing disclosure under Rule 15c2-12 promulgated by the Securities and Exchange Commission under the Securities Exchange Act of 1934 as described in the Preliminary Official Statement for the Bonds. We have received and reviewed the Official Statement, and any addenda thereto, and have submitted our requests for additional information or corrections to the Final Official Statement. As Syndicate Manager, we agree to provide the City with the reoffering price of the Bonds within 24 hours of the proposal acceptance. This proposal is a firm offer for the purchase of the Bonds identified in the Terms of Proposal, on the terms set forth in this proposal form and the Terms of Proposal, and is not subject to any conditions, except as permitted by the Terms of Proposal. By submitting this proposal, we confirm that we are an underwriter and have an established industry reputation for underwriting new issuances of municipal bonds. YES: ____ NO: ____. If the competitive sale requirements are not met, we elect to use either the: _____10% test, or the _____hold-the-offering-price rule to determine the issue price of the Bonds. Account Manager:By: Account Members: Award will be on a true interest cost basis. According to our computations (the correct computation being controlling in the award), the total dollar interest cost (including any discount or less any premium) computed from August 25, 2022 of the above proposal is $_______________and the true interest cost (TIC) is __________%. The foregoing offer is hereby accepted by and on behalf of the City Council of the City of Edina, Minnesota, on August 3, 2022. By:By: Title:Title: 4876-2177-1303\3 CERTIFICATION OF MINUTES RELATING TO $17,000,000 GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B City: City of Edina, Minnesota Governing Body: City Council Kind, date, time and place of meeting: A regular meeting held on August 3, 2022, at 7:00 o’clock p.m., at City Hall, Edina, Minnesota. Members present: Members absent: Documents Attached: Minutes of said meeting (including): RESOLUTION NO. 2022-70 RESOLUTION AUTHORIZING ISSUANCE, AWARDING SALE, PRESCRIBING THE FORM AND DETAILS AND PROVIDING FOR THE PAYMENT OF $17,000,000 GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B I, the undersigned, being the duly qualified and acting recording officer of the public corporation issuing the bonds referred to in the title of this certificate, certify that the documents attached hereto, as described above, have been carefully compared with the original records of said corporation in my legal custody, from which they have been transcribed; that said documents are a correct and complete transcript of the minutes of a meeting of the governing body of said corporation, and correct and complete copies of all resolutions and other actions taken and of all documents approved by the governing body at said meeting, so far as they relate to said bonds; and that said meeting was duly held by the governing body at the time and place and was attended throughout by the members indicated above, pursuant to call and notice of such meeting given as required by law. WITNESS my hand officially as such recording officer on ____________, 2022. Sharon Allison, City Clerk 4876-2177-1303\3 It was reported that five (5) proposals for the purchase of $17,000,000 General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B were received prior to 10 o’clock a.m., Central time, pursuant to the Official Statement distributed to potential purchasers of the Bonds by Ehlers & Associates, Inc., municipal advisors to the City. The proposals have been publicly opened, read and tabulated and were found to be as follows: (See Attached) 4876-2177-1303\3 2 4876-2177-1303\3 3 Councilmember ________________ introduced the following resolution and moved its adoption, which motion was seconded by Councilmember ____________________: RESOLUTION NO. 2022-70 RESOLUTION AUTHORIZING ISSUANCE, AWARDING SALE, PRESCRIBING THE FORM AND DETAILS AND PROVIDING FOR THE PAYMENT OF $17,000,000 GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B BE IT RESOLVED by the City Council (the “Council”) of the City of Edina, Minnesota (the “City”), as follows: SECTION 1. AUTHORIZATION AND SALE. 1.01. Authorization. On June 21, 2022, this Council held a public hearing on the questions of approving the City’s Capital Improvement Plan (the “Plan”) and issuing General Obligation Capital Improvement Plan Bonds, after notice duly published in the official newspaper of the City as set forth in Minnesota Statutes, Section 475.521. By resolution duly adopted on June 21, 2022, the Council approved the Plan and authorized the issuance of CIP Bonds in a principal amount not to exceed $39,000,000, to finance various improvements as identified in the Plan, and authorized the sale on the date hereof of the City’s General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B, in a principal amount not to exceed $17,000,000 (the “Bonds”) to finance capital improvements identified in the Plan, including capital improvements related to the City’s Fire Station #2 Facility Project (the “Project”). No petition was filed requesting a vote on the issuance of the CIP Bonds within 30 days following the public hearing. The maximum amount of principal and interest due on the Bonds in any year, combined with the maximum debt service on all other obligations issued by the City under Minnesota Statutes, Section 475.521 (not in excess of $2,182,575), does not exceed 0.16% ($22,074,210) of the estimated market value of all taxable property in the City ($13,796,381,100). This Council finds, determines and declares that all conditions precedent to the offering for sale of definitive capital improvement plan bonds (“Definitive Bonds”) exist. Pursuant to Minnesota Statutes, Section 475.61, Subdivision 6, as amended, the City is authorized to issue its general obligation temporary bonds in anticipation of the issuance of the Definitive Bonds or additional temporary obligations. The Bonds are issued pursuant to Minnesota Statutes, Section 475.521 and Chapter 475. 1.02. Sale. Pursuant to the Terms of Proposal and the Official Statement prepared on behalf of the City by Ehlers & Associates, Inc., municipal advisor to the City, sealed proposals for the purchase of the Bonds were received at or before the time specified for receipt of proposals. The proposals have been opened, publicly read and considered and the purchase price, interest rates and net interest cost under the terms of each proposal have been determined. The most favorable proposal received is that of Morgan Stanley & Co, LLC, in New York, New York (the 4876-2177-1303\3 4 “Purchaser”), and associates, to purchase the Bonds in the principal amount of $17,000,000 at a price of $16,946,762.36 plus accrued interest, if any, on all Bonds to the day of issuance and delivery, on the further terms and conditions hereinafter set forth. 1.03. Award. The sale of the Bonds is hereby awarded to the Purchaser, and the Mayor and City Manager are hereby authorized and directed to execute a contract on behalf of the City for the sale of the Bonds in accordance with the terms of the proposal. The good faith deposit of the Purchaser shall be retained and deposited by the City until the Bonds have been delivered, and shall be deducted from the purchase price paid at settlement. SECTION 2. BOND TERMS; REGISTRATION; EXECUTION AND DELIVERY. 2.01. Issuance of Bonds. All acts, conditions and things which are required by the Constitution and laws of the State of Minnesota to be done, to exist, to happen and to be performed precedent to and in the valid issuance of the Bonds having been done, now existing, having happened and having been performed, it is now necessary for the Council to establish the form and terms of the Bonds, to provide security therefor and to issue the Bonds forthwith. 2.02. Maturities; Interest Rates; Denominations and Payment. The Bonds shall be originally dated as of the date of issuance thereof, shall be in the denomination of $5,000 each, or any integral multiple thereof, of single maturities, shall mature on February 1 in the years and amounts stated below, and shall bear interest from their date of original issue until paid or duly called for redemption at the annual rates set forth opposite such years and amounts, as follows: Year Amount ($) Rate (%) 2025 17,000,000 2.000 The Bonds shall be issuable only in fully registered form. The interest thereon and, upon surrender of each Bond at the principal office of the Registrar (as hereinafter defined), the principal amount thereof, shall be payable by check or draft issued by the Registrar; provided that, so long as the Bonds are registered in the name of a securities depository, or a nominee thereof, in accordance with Section 2.08 hereof, principal and interest shall be payable in accordance with the operational arrangements of the securities depository. 2.03. Dates and Interest Payment Dates. Upon initial delivery of the Bonds pursuant to Section 2.07 and upon any subsequent transfer or exchange pursuant to Section 2.06, the date of authentication shall be noted on each Bond so delivered, exchanged or transferred. Interest on the Bonds shall be payable on February 1 and August 1 in each year, commencing August 1, 2023, each such date being referred to herein as an Interest Payment Date, to the persons in whose names the Bonds are registered on the Bond Register, as hereinafter defined, at the Registrar’s close of business on the fifteenth day of the calendar month next preceding such Interest Payment Date, whether or not such day is a business day. Interest shall be computed on the basis of a 360-day year composed of twelve 30-day months. 2.04. Redemption. The Bonds shall be subject to redemption and prepayment at the option of the City, in whole or in part, by lot as selected by the Registrar, in multiples of $5,000, on February 1, 2024, and any date thereafter, at a price equal to the principal amount thereof plus accrued interest to the date of redemption. Prior to the date specified for the redemption of any 4876-2177-1303\3 5 Bond prior to its stated maturity date, the City will cause notice of the call for redemption to be published if and as required by law, and, at least thirty days prior to the designated redemption date, will cause notice of the call to be mailed by first class mail (or, if applicable, provided in accordance with the operational arrangements of the bond depository), to the registered owner of any Bond to be redeemed at the owner’s address as it appears on the Bond Register maintained by the Registrar, but no defect in or failure to give such mailed notice of redemption shall affect the validity of proceedings for the redemption of any Bond not affected by such defect or failure. Official notice of redemption having been given as aforesaid, the Bonds or portions of Bonds so to be redeemed shall, on the redemption date, become due and payable at the redemption price therein specified, and from and after such date (unless the City shall default in the payment of the redemption price) such Bonds or portions of such Bonds shall cease to bear interest. Upon partial redemption of any Bond, a new Bond or Bonds will be delivered to the registered owner without charge, representing the remaining principal amount outstanding. 2.05. Appointment of Initial Registrar. The City hereby appoints U.S. Bank Trust Company, National Association, St. Paul, Minnesota, as the initial bond registrar, transfer agent and paying agent (the “Registrar”). The Mayor and the City Manager are authorized to execute and deliver, on behalf of the City, a contract with the Registrar. Upon merger or consolidation of the Registrar with another corporation, if the resulting corporation is a bank or trust company authorized by law to conduct such business, such corporation shall be authorized to act as successor Registrar. The City agrees to pay the reasonable and customary charges of the Registrar for the services performed. The City reserves the right to remove the Registrar upon thirty days’ notice and upon the appointment of a successor Registrar, in which event the predecessor Registrar shall deliver all cash and Bonds in its possession to the successor Registrar and shall deliver the bond register to the successor Registrar. 2.06. Registration. The effect of registration and the rights and duties of the City and the Registrar with respect thereto shall be as follows: (a) Register. The Registrar shall keep at its principal corporate trust office a bond register in which the Registrar shall provide for the registration of ownership of Bonds and the registration of transfers and exchanges of Bonds entitled to be registered, transferred or exchanged. (b) Transfer of Bonds. Upon surrender for transfer of any Bond duly endorsed by the registered owner thereof or accompanied by a written instrument of transfer, in form satisfactory to the Registrar, duly executed by the registered owner thereof or by an attorney duly authorized by the registered owner in writing, the Registrar shall authenticate and deliver, in the name of the designated transferee or transferees, one or more new Bonds of a like aggregate principal amount and maturity, as requested by the transferor. The Registrar may, however, close the books for registration of any transfer after the fifteenth day of the month preceding each interest payment date and until such interest payment date. (c) Exchange of Bonds. Whenever any Bonds are surrendered by the registered owner for exchange the Registrar shall authenticate and deliver one or more new Bonds of 4876-2177-1303\3 6 a like aggregate principal amount and maturity, as requested by the registered owner or the owner’s attorney in writing. (d) Cancellation. All Bonds surrendered upon any transfer or exchange shall be promptly canceled by the Registrar and thereafter disposed of as directed by the City. (e) Improper or Unauthorized Transfer. When any Bond is presented to the Registrar for transfer, the Registrar may refuse to transfer the same until it is satisfied that the endorsement on such Bond or separate instrument of transfer is valid and genuine and that the requested transfer is legally authorized. The Registrar shall incur no liability for the refusal, in good faith, to make transfers which it, in its judgment, deems improper or unauthorized. (f) Persons Deemed Owners. The City and the Registrar may treat the person in whose name any Bond is at any time registered in the bond register as the absolute owner of such Bond, whether such Bond shall be overdue or not, for the purpose of receiving payment of, or on account of, the principal of and interest on such Bond and for all other purposes, and all such payments so made to any such registered owner or upon the owner’s order shall be valid and effectual to satisfy and discharge the liability upon such Bond to the extent of the sum or sums so paid. (g) Taxes, Fees and Charges. For every transfer or exchange of Bonds (except for an exchange upon partial redemption), the Registrar may impose a charge upon the owner thereof sufficient to reimburse the Registrar for any tax, fee or other governmental charge required to be paid with respect to such transfer or exchange. (h) Mutilated, Lost, Stolen or Destroyed Bonds. In case any Bond shall become mutilated or be destroyed, stolen or lost, the Registrar shall deliver a new Bond of like amount, number, maturity date and tenor in exchange and substitution for and upon cancellation of any such mutilated Bond or in lieu of and in substitution for any such Bond destroyed, stolen or lost, upon the payment of the reasonable expenses and charges of the Registrar in connection therewith; and, in the case of a Bond destroyed, stolen or lost, upon filing with the Registrar of evidence satisfactory to it that such Bond was destroyed, stolen or lost, and of the ownership thereof, and upon furnishing to the Registrar of an appropriate bond or indemnity in form, substance and amount satisfactory to it, in which both the City and the Registrar shall be named as obligees. All Bonds so surrendered to the Registrar shall be canceled by it and evidence of such cancellation shall be given to the City. If the mutilated, destroyed, stolen or lost Bond has already matured or been called for redemption in accordance with its terms it shall not be necessary to issue a new Bond prior to payment. (i) Authenticating Agent. The Registrar is hereby designated authenticating agent for the Bonds, within the meaning of Minnesota Statutes, Section 475.55, Subdivision 1, as amended. (j) Valid Obligations. All Bonds issued upon any transfer or exchange of Bonds shall be the valid obligations of the City, evidencing the same debt, and entitled to 4876-2177-1303\3 7 the same benefits under this Resolution as the Bonds surrendered upon such transfer or exchange. 2.07. Execution, Authentication and Delivery. The Bonds shall be prepared under the direction of the City Finance Director and shall be executed on behalf of the City by the signatures of the Mayor and the City Manager, provided that all signatures may be printed, engraved or lithographed facsimiles of the originals. In case any officer whose signature or a facsimile of whose signature shall appear on the Bonds shall cease to be such officer before the delivery of any Bond, such signature or facsimile shall nevertheless be valid and sufficient for all purposes, the same as if he or she had remained in office until delivery. Notwithstanding such execution, no Bond shall be valid or obligatory for any purpose or entitled to any security or benefit under this Resolution unless and until a certificate of authentication on such Bond has been duly executed by the manual signature of an authorized representative of the Registrar. Certificates of authentication on different Bonds need not be signed by the same representative. The executed certificate of authentication on each Bond shall be conclusive evidence that it has been authenticated and delivered under this Resolution. When the Bonds have been so prepared, executed and authenticated, the City Finance Director shall deliver them to the Purchaser upon payment of the purchase price in accordance with the contract of sale heretofore made and executed, and the Purchaser shall not be obligated to see to the application of the purchase price. 2.08. Securities Depository. (a) For purposes of this section the following terms shall have the following meanings: “Beneficial Owner” shall mean, whenever used with respect to a Bond, the person in whose name such Bond is recorded as the beneficial owner of such Bond by a Participant on the records of such Participant, or such person’s subrogee. “Cede & Co.” shall mean Cede & Co., the nominee of DTC, and any successor nominee of DTC with respect to the Bonds. “DTC” shall mean The Depository Trust Company of New York, New York. “Participant” shall mean any broker-dealer, bank or other financial institution for which DTC holds Bonds as securities depository. “Representation Letter” shall mean the Representation Letter pursuant to which the sender agrees to comply with DTC’s Operational Arrangements. (b) The Bonds shall be initially issued as separately authenticated fully registered bonds, and one Bond shall be issued in the principal amount of each stated maturity of the Bonds. Upon initial issuance, the ownership of such Bonds shall be registered in the bond register in the name of Cede & Co., as nominee of DTC. The Registrar and the City may treat DTC (or its nominee) as the sole and exclusive owner of the Bonds registered in its name for the purposes of payment of the principal of or interest on the Bonds, selecting the Bonds or portions thereof to be redeemed, if any, giving any notice permitted or required to be given to registered owners of Bonds under this resolution, registering the transfer of Bonds, and for all other purposes whatsoever; and neither the Registrar nor the City shall be affected by any notice to the contrary. Neither the Registrar nor the City shall have any responsibility or obligation to any Participant, any person 4876-2177-1303\3 8 claiming a beneficial ownership interest in the Bonds under or through DTC or any Participant, or any other person which is not shown on the bond register as being a registered owner of any Bonds, with respect to the accuracy of any records maintained by DTC or any Participant, with respect to the payment by DTC or any Participant of any amount with respect to the principal of or interest on the Bonds, with respect to any notice which is permitted or required to be given to owners of Bonds under this resolution, with respect to the selection by DTC or any Participant of any person to receive payment in the event of a partial redemption of the Bonds, or with respect to any consent given or other action taken by DTC as registered owner of the Bonds. So long as any Bond is registered in the name of Cede & Co., as nominee of DTC, the Registrar shall pay all principal of and interest on such Bond, and shall give all notices with respect to such Bond, only to Cede & Co. in accordance with DTC’s Operational Arrangements, and all such payments shall be valid and effective to fully satisfy and discharge the City’s obligations with respect to the principal of and interest on the Bonds to the extent of the sum or sums so paid. No person other than DTC shall receive an authenticated Bond for each separate stated maturity evidencing the obligation of the City to make payments of principal and interest. Upon delivery by DTC to the Registrar of written notice to the effect that DTC has determined to substitute a new nominee in place of Cede & Co., the Bonds will be transferable to such new nominee in accordance with paragraph (e) hereof. (c) In the event the City determines that it is in the best interest of the Beneficial Owners that they be able to obtain Bonds in the form of bond certificates, the City may notify DTC and the Registrar, whereupon DTC shall notify the Participants of the availability through DTC of Bonds in the form of certificates. In such event, the Bonds will be transferable in accordance with paragraph (e) hereof. DTC may determine to discontinue providing its services with respect to the Bonds at any time by giving notice to the City and the Registrar and discharging its responsibilities with respect thereto under applicable law. In such event the Bonds will be transferable in accordance with paragraph (e) hereof. (d) The execution and delivery of the Representation Letter to DTC, if not previously filed with DTC, by the Mayor or Clerk is hereby authorized and directed. (e) In the event that any transfer or exchange of Bonds is permitted under paragraph (b) or (c) hereof, such transfer or exchange shall be accomplished upon receipt by the Registrar of the Bonds to be transferred or exchanged and appropriate instruments of transfer to the permitted transferee in accordance with the provisions of this resolution. In the event Bonds in the form of certificates are issued to owners other than Cede & Co., its successor as nominee for DTC as owner of all the Bonds, or another securities depository as owner of all the Bonds, the provisions of this resolution shall also apply to all matters relating thereto, including, without limitation, the printing of such Bonds in the form of bond certificates and the method of payment of principal of and interest on such Bonds in the form of bond certificates. 2.09. Form of Bonds. The Bonds shall be printed in substantially the form found at Exhibit A hereto. SECTION 3. GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B CONSTRUCTION FUND. There is hereby established on the official books and records of the City a General Obligation Temporary Capital Improvement Plan Bonds, 4876-2177-1303\3 9 Series 2022B Construction Fund (the “Construction Fund”). The City Finance Director shall maintain the Construction Fund until payment of all costs and expenses incurred in connection with the construction of the Project have been paid. To the Construction Fund there shall be credited from the proceeds of the Bonds an amount equal to $16,459,429.03, representing the estimated costs of the Project ($16,357,629.03) and costs of issuance of the Bonds ($101,800.00). From the Construction Fund there shall be paid all construction costs and expenses incurred by the City in construction of the Project. After payment of all construction costs, the Construction Fund shall be discontinued and any Bond proceeds remaining therein received shall be credited to the Bond Fund described in Section 4.01 hereof. SECTION 4. GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BONDS, SERIES 2022B BOND FUND; PLEDGE OF TAXING POWER. 4.01. General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B Bond Fund. So long as any of the Bonds are outstanding and any principal of or interest thereon unpaid, the City Finance Director shall maintain a separate debt service fund on the official books and records of the City to be known as the General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B Bond Fund (the “Bond Fund”), and the principal of and interest on the Bonds shall be payable from the Bond Fund. The City irrevocably appropriates to the Bond Fund (i) Bond proceeds in the amount of $487,333.33, representing capitalized interest; (ii) the amounts specified in Section 3 above, after payment of all costs of the Project; (iii) all taxes levied and collected in accordance with this resolution; and (iv) all other moneys as shall be appropriated by the Council to the Bond Fund from time to time. If the aggregate balance in the Bond Fund is at any time insufficient to pay all interest and principal then due on all Bonds payable therefrom, the payment shall be made from any fund of the City which is available for that purpose, subject to reimbursement from the Bond Fund when the balance therein is sufficient, and the Council covenants and agrees that it will each year levy a sufficient amount of ad valorem taxes to take care of any accumulated or anticipated deficiency, which levy is not subject to any constitutional or statutory limitation. 4.02. Pledge of Taxing Powers. The full faith and credit of the City are irrevocably pledged for the prompt and full payment of the principal of and the interest on the Bonds, and the Bonds shall be payable from the Bond Fund in accordance with the provisions and covenants contained in this Resolution. It is estimated that capitalized interest and proceeds of definitive bonds will be will be sufficient to produce sums not less than five percent in excess of the principal of and interest on the Bonds when due; but if necessary for payment of such principal and interest, ad valorem taxes are required to be levied upon all taxable property in the City, without limitation as to rate or amount. 4.03. Refunding. The City hereby covenants and agrees that at or prior to the maturity of the Bonds it will sell and issue its Definitive Bonds or additional temporary bonds pursuant to Minnesota Statutes, Section 475.61, subd. 6, in an aggregate principal amount at least sufficient to provide the amount needed, together with any other money appropriated to the Bond Fund, to pay the principal of and interest on the Bonds due at their maturity. If the Bonds are not paid in full at maturity, the registered owners thereof shall have the right to require the City to issue and 4876-2177-1303\3 10 exchange, at par, new temporary bonds for the Bonds, maturing within one year from their date of issuance and bearing interest at the maximum rate permitted by law. SECTION 5. DEFEASANCE. When all of the Bonds have been discharged as provided in this section, all pledges, covenants and other rights granted by this resolution to the registered owners of the Bonds shall cease. The City may discharge its obligations with respect to any Bonds which are due on any date by irrevocably depositing with the Registrar on or before that date a sum sufficient for the payment thereof in full, or, if any Bond should not be paid when due, it may nevertheless be discharged by depositing with the Registrar a sum sufficient for the payment thereof in full with interest accrued from the due date to the date of such deposit. The City may also discharge its obligations with respect to any prepayable Bonds called for redemption on any date when they are prepayable according to their terms by depositing with the Registrar on or before that date an amount equal to the principal, redemption premium, if any, and interest then due, provided that notice of such redemption has been duly given as provided herein. The City may also at any time discharge its obligations with respect to any Bonds, subject to the provisions of law now or hereafter authorizing and regulating such action, by depositing irrevocably in escrow, with the Registrar or with a bank or trust company qualified by law to act as an escrow agent for this purpose, cash or securities which are authorized by law to be so deposited for such purpose, bearing interest payable at such times and at such rates and maturing or callable at the holder’s option on such dates as shall be required to pay all principal and interest to become due thereon to maturity or, if notice of redemption as herein required has been irrevocably provided for, to an earlier designated redemption date, provided, however, that if such deposit is made more than ninety days before the maturity date or specified redemption date of the Bonds to be discharged, the City shall have received a written opinion of Bond Counsel to the effect that such deposit does not adversely affect the exemption of interest on any Bonds from federal income taxation and a written report of an accountant or investment banking firm verifying that the deposit is sufficient to pay when due all of the principal and interest on the Bonds to be discharged on and before their maturity dates or earlier designated redemption date. SECTION 6. CERTIFICATION OF PROCEEDINGS. 6.01. Registration of Bonds. The City Clerk is hereby authorized and directed to file a certified copy of this Resolution with the County Auditor of Hennepin County, together with such additional information as the Auditor may require, and to obtain from the Auditor a certificate that the Bonds have been duly entered upon the Auditor’s bond register. 6.02. Authentication of Transcript. The officers of the City and the County Auditor are hereby authorized and directed to prepare and furnish to the Purchaser and to Dorsey & Whitney LLP, Bond Counsel, certified copies of all proceedings and records relating to the Bonds and such other affidavits, certificates and information as may be required to show the facts relating to the legality and marketability of the Bonds, as the same appear from the books and records in their custody and control or as otherwise known to them, and all such certified copies, affidavits and certificates, including any heretofore furnished, shall be deemed representations of the City as to the correctness of all statements contained therein. 6.03. Official Statement. The Official Statement relating to the Bonds, prepared and distributed by Ehlers & Associates, Inc., is hereby approved. Ehlers & Associates, Inc. is hereby 4876-2177-1303\3 11 authorized on behalf of the City to prepare and distribute to the Purchaser within seven business days from the date hereof, a supplement to the Official Statement listing the offering price, the interest rates, selling compensation, delivery date, the underwriters and such other information relating to the Bonds as is required to be included in the Official Statement by Rule l5c2-12 adopted by the Securities and Exchange Commission (the “SEC”) under the Securities Exchange Act of 1934. The officers of the City are hereby authorized and directed to execute such certificates as may be appropriate concerning the accuracy, completeness and sufficiency of the Official Statement. 6.04. Authorization of Payment of Certain Costs of Issuance of the Bonds. The City authorizes the Purchaser to forward the amount of Bond proceeds allocable to the payment of issuance expenses to Wells Fargo Bank, National Association on the closing date for further distribution as directed by Ehlers & Associates, Inc. SECTION 7. TAX COVENANTS; ARBITRAGE MATTERS AND CONTINUING DISCLOSURE. 7.01. General Tax Covenant. The City covenants and agrees with the registered owners of the Bonds that it will not take or permit to be taken by any of its officers, employees or agents any actions that would cause interest on the Bonds to become includable in the gross income of the recipient under the Internal Revenue Code of 1986, as amended (the “Code”) and applicable Treasury Regulations (the “Regulations”), and covenants to take any and all actions within its powers to ensure that the interest on the Bonds will not become includable in gross income of the recipient under the Code and the Regulations. In particular, the City covenants and agrees that all proceeds of the Bonds deposited in the Construction Fund will be expended solely for the payment of the costs of the Project. All improvements so financed will be owned and maintained by the City as part of the public infrastructure of the City and available for use by members of the general public on a substantially equal basis. The City has not entered and will not enter into any lease, management, use or other agreement or contract relating to the use of the Project, or any portion thereof, or security for the payment of the Bonds which might cause the Bonds to be considered “private activity bonds” or “private loan bonds” pursuant to Section 141 of the Code. 7.02. Arbitrage Certification. The Mayor and City Manager, being the officers of the City charged with the responsibility for issuing the Bonds pursuant to this resolution, are authorized and directed to execute and deliver to the Purchaser a certificate in accordance with Section 148 of the Code and applicable Regulations stating the facts, estimates and circumstances in existence on the date of issue and delivery of the Bonds which make it reasonable to expect that the proceeds of the Bonds will not be used in a manner that would cause the Bonds to be “arbitrage bonds” within the meaning of the Code and Regulations. 7.03. Arbitrage Rebate. The City acknowledges that the Bonds may be subject to the rebate requirements of Section 148(f) of the Code. The City covenants and agrees to retain such records, make such determinations, file such reports and documents and pay such amounts at such times as are required under said Section 148(f) and applicable Regulations to preserve the exclusion of interest on the Bonds from gross income for federal income tax purposes, unless the Bonds qualify for an exception from the rebate requirement pursuant to one of the spending exceptions set forth in Section 1.148-7 of the Regulations and no “gross proceeds” of the Bonds 4876-2177-1303\3 12 (other than amounts constituting a “bona fide debt service fund”) arise during or after the expenditure of the original proceeds thereof. 7.04. Not Qualified Tax-Exempt Obligations. The Bonds are not designated as “qualified tax-exempt obligations” for purposes of Section 265(b)(3) of the Code relating to the disallowance of interest expense for financial institutions. 7.05. Reimbursement. The City certifies that the proceeds of the Bonds will not be used by the City to reimburse itself for any expenditure with respect to the Project which the City paid or will have paid more than 60 days prior to the issuance of the Bonds unless, with respect to such prior expenditures, the City shall have made a declaration of official intent which complies with the provisions of Section 1.150-2 of the Regulations, provided that this certification shall not apply (i) with respect to certain de minimis expenditures, if any, with respect to the Project meeting the requirements of Section 1.150-2(f)(1) of the Regulations, or (ii) with respect to “preliminary expenditures” for the Project as defined in Section 1.150-2(f)(2) of the Regulations, including engineering or architectural expenses and similar preparatory expenses, which in the aggregate do not exceed 20% of the “issue price” of the Bonds. 7.06. Continuing Disclosure. (a) Purpose and Beneficiaries. To provide for the public availability of certain information relating to the Bonds and the security therefor and to permit the Purchaser and other participating underwriters in the primary offering of the Bonds to comply with amendments to Rule 15c2-12 promulgated by the SEC under the Securities Exchange Act of 1934 (17 C.F.R. § 240.15c2-12), relating to continuing disclosure (as in effect and interpreted from time to time, the Rule), which will enhance the marketability of the Bonds, the City hereby makes the following covenants and agreements for the benefit of the Owners (as hereinafter defined) from time to time of the Outstanding Bonds. The City is the only obligated person in respect of the Bonds within the meaning of the Rule for purposes of identifying the entities in respect of which continuing disclosure must be made. If the City fails to comply with any provisions of this section, any person aggrieved thereby, including the Owners of any Outstanding Bonds, may take whatever action at law or in equity may appear necessary or appropriate to enforce performance and observance of any agreement or covenant contained in this section, including an action for a writ of mandamus or specific performance. Direct, indirect, consequential and punitive damages shall not be recoverable for any default hereunder to the extent permitted by law. Notwithstanding anything to the contrary contained herein, in no event shall a default under this section constitute a default under the Bonds or under any other provision of this resolution. As used in this section, Owner or Bondowner means, in respect of a Bond, the registered owner or owners thereof appearing in the bond register maintained by the Registrar or any Beneficial Owner (as hereinafter defined) thereof, if such Beneficial Owner provides to the Registrar evidence of such beneficial ownership in form and substance reasonably satisfactory to the Registrar. As used herein, Beneficial Owner means, in respect of a Bond, any person or entity which (i) has the power, directly or indirectly, to vote or consent with respect to, or to dispose of ownership of, such Bond (including persons or entities holding Bonds through nominees, depositories or other intermediaries), or (ii) is treated as the owner of the Bond for federal income tax purposes. (b) Information To Be Disclosed. The City will provide, in the manner set forth in subsection (c) hereof, either directly or indirectly through an agent designated by the City, the following information at the following times: 4876-2177-1303\3 13 (1) on or before twelve (12) months after the end of each fiscal year of the City, commencing with the fiscal year ending December 31, 2022, the following financial information and operating data in respect of the City (the “Disclosure Information”): (A) the audited financial statements of the City for such fiscal year, prepared in accordance with generally accepted accounting principles in accordance with the governmental accounting standards promulgated by the Governmental Accounting Standards Board or as otherwise provided under Minnesota law, as in effect from time to time, or, if and to the extent such financial statements have not been prepared in accordance with such generally accepted accounting principles for reasons beyond the reasonable control of the City, noting the discrepancies therefrom and the effect thereof, and certified as to accuracy and completeness in all material respects by the fiscal officer of the City; and (B) to the extent not included in the financial statements referred to in paragraph (A) hereof, the information for such fiscal year or for the period most recently available of the type contained in the Official Statement under headings: Current Property Valuations, Direct Debt, Tax Levies and Collections, US Census Data/Population Trend, and Employment/Unemployment Data. Notwithstanding the foregoing paragraph, if the audited financial statements are not available by the date specified, the City shall provide on or before such date unaudited financial statements in the format required for the audited financial statements as part of the Disclosure Information and, within 10 days after the receipt thereof, the City shall provide the audited financial statements. Any or all of the Disclosure Information may be incorporated by reference, if it is updated as required hereby, from other documents, including official statements, which have been submitted to the Municipal Securities Rulemaking Board (“MSRB”) through its Electronic Municipal Market Access System (“EMMA”) or to the SEC. If the document incorporated by reference is a final official statement, it must be available from the MSRB. The City shall clearly identify in the Disclosure Information each document so incorporated by reference. If any part of the Disclosure Information can no longer be generated because the operations of the City have materially changed or been discontinued, such Disclosure Information need no longer be provided if the City includes in the Disclosure Information a statement to such effect, provided, however, that if such operations have been replaced by other City operations in respect of which data is not included in the Disclosure Information and the City determines that certain specified data regarding such replacement operations would be a Material Fact (as defined in paragraph (2) hereof), then, from and after such determination, the Disclosure Information shall include such additional specified data regarding the replacement operations. If the Disclosure Information is changed or this section is amended as permitted by this paragraph (b)(1) or subsection (d), then the City shall include in the next Disclosure Information to be delivered hereunder, to the extent necessary, an explanation of the reasons for the amendment and the effect of any change in the type of financial information or operating data provided. 4876-2177-1303\3 14 (2) In a timely manner not in excess of ten business days after the occurrence of the event, notice of the occurrence of any of the following events (each a Material Fact): (A) Principal and interest payment delinquencies; (B) Non-payment related defaults, if material; (C) Unscheduled draws on debt service reserves reflecting financial difficulties; (D) Unscheduled draws on credit enhancements reflecting financial difficulties; (E) Substitution of credit or liquidity providers, or their failure to perform; (F) Adverse tax opinions, the issuance by the Internal Revenue Service of proposed or final determinations of taxability, Notices of Proposed Issue (IRS Form 5701-TEB) or other material notices or determinations with respect to the tax status of the security, or other material events affecting the tax status of the security; (G) Modifications to rights of security holders, if material; (H) Bond calls, if material, and tender offers; (I) Defeasances; (J) Release, substitution, or sale of property securing repayment of the securities, if material; (K) Rating changes; (L) Bankruptcy, insolvency, receivership or similar event of the obligated person; (M) The consummation of a merger, consolidation, or acquisition involving an obligated person or the sale of all or substantially all of the assets of the obligated person, other than in the ordinary course of business, the entry into a definitive agreement to undertake such an action or the termination of a definitive agreement relating to any such actions, other than pursuant to its terms, if material; (N) Appointment of a successor or additional trustee or the change of name of a trustee, if material; (O) Incurrence of a financial obligation of the obligated person, if material, or agreement to covenants, events of default, remedies, priority rights, or other similar terms of a financial obligation of the obligated person, any of which affect security holders, if material; and (P) Default, event of acceleration, termination event, modification of terms, or other similar events under the terms of a financial obligation of the obligated person, any of which reflect financial difficulties. For purposes of the events identified in paragraphs (O) and (P) above, the term “financial obligation” means (i) a debt obligation; (ii) a derivative instrument entered into in connection with, or pledged as security or a source of payment for, an existing or planned debt obligation; or (iii) a guarantee of (i) or (ii). The term “financial obligation” shall not include municipal securities as to which a final official statement has been provided to the MSRB consistent with the Rule. As used herein, for those events that must be reported if material, an event is “material” if it is an event as to which a substantial likelihood exists that a reasonably prudent investor would attach 4876-2177-1303\3 15 importance thereto in deciding to buy, hold or sell a Bond or, if not disclosed, would significantly alter the total information otherwise available to an investor from the Official Statement, information disclosed hereunder or information generally available to the public. Notwithstanding the foregoing sentence, an event is also “material” if it is an event that would be deemed material for purposes of the purchase, holding or sale of a Bond within the meaning of applicable federal securities laws, as interpreted at the time of discovery of the occurrence of the event. For the purposes of the event identified in (L) hereinabove, the event is considered to occur when any of the following occur: the appointment of a receiver, fiscal agent or similar officer for an obligated person in a proceeding under the U.S. Bankruptcy Code or in any other proceeding under state or federal law in which a court or governmental authority has assumed jurisdiction over substantially all of the assets or business of the obligated person, or if such jurisdiction has been assumed by leaving the existing governing body and officials or officers in possession but subject to the supervision and orders of a court or governmental authority, or the entry of an order confirming a plan of reorganization, arrangement or liquidation by a court or governmental authority having supervision or jurisdiction over substantially all of the assets or business of the obligated person. (3) In a timely manner, notice of the occurrence of any of the following events or conditions: (A) the failure of the City to provide the Disclosure Information required under paragraph (b)(1) at the time specified thereunder; (B) the amendment or supplementing of this section pursuant to subsection (d), together with a copy of such amendment or supplement and any explanation provided by the City under subsection (d)(2); (C) the termination of the obligations of the City under this section pursuant to subsection (d); (D) any change in the accounting principles pursuant to which the financial statements constituting a portion of the Disclosure Information are prepared; and (E) any change in the fiscal year of the City. (c) Manner of Disclosure. (1) The City agrees to make available to the MSRB through EMMA, in an electronic format as prescribed by the MSRB, the information described in subsection (b). (2) All documents provided to the MSRB pursuant to this subsection (c) shall be accompanied by identifying information as prescribed by the MSRB from time to time. (d) Term; Amendments; Interpretation. (1) The covenants of the City in this section shall remain in effect so long as any Bonds are Outstanding. Notwithstanding the preceding sentence, however, the obligations 4876-2177-1303\3 16 of the City under this section shall terminate and be without further effect as of any date on which the City delivers to the Registrar an opinion of Bond Counsel to the effect that, because of legislative action or final judicial or administrative actions or proceedings, the failure of the City to comply with the requirements of this section will not cause participating underwriters in the primary offering of the Bonds to be in violation of the Rule or other applicable requirements of the Securities Exchange Act of 1934, as amended, or any statutes or laws successory thereto or amendatory thereof. (2) This section (and the form and requirements of the Disclosure Information) may be amended or supplemented by the City from time to time, without notice to (except as provided in paragraph (c)(3) hereof) or the consent of the Owners of any Bonds, by a resolution of this Council filed in the office of the recording officer of the City accompanied by an opinion of Bond Counsel, who may rely on certificates of the City and others and the opinion may be subject to customary qualifications, to the effect that: (i) such amendment or supplement (a) is made in connection with a change in circumstances that arises from a change in law or regulation or a change in the identity, nature or status of the City or the type of operations conducted by the City, or (b) is required by, or better complies with, the provisions of paragraph (b)(5) of the Rule; (ii) this section as so amended or supplemented would have complied with the requirements of paragraph (b)(5) of the Rule at the time of the primary offering of the Bonds, giving effect to any change in circumstances applicable under clause (i)(a) and assuming that the Rule as in effect and interpreted at the time of the amendment or supplement was in effect at the time of the primary offering; and (iii) such amendment or supplement does not materially impair the interests of the Bondowners under the Rule. If the Disclosure Information is so amended, the City agrees to provide, contemporaneously with the effectiveness of such amendment, an explanation of the reasons for the amendment and the effect, if any, of the change in the type of financial information or operating data being provided hereunder. (3) This section is entered into to comply with the continuing disclosure provisions of the Rule and should be construed so as to satisfy the requirements of paragraph (b)(5) of the Rule. Upon vote being taken thereon, the following voted in favor thereof: and the following voted against the same: whereupon the resolution was declared duly passed and adopted. 4876-2177-1303\3 EXHIBIT A UNITED STATES OF AMERICA STATE OF MINNESOTA HENNEPIN COUNTY CITY OF EDINA GENERAL OBLIGATION TEMPORARY CAPITAL IMPROVEMENT PLAN BOND, SERIES 2022B R-1 $17,000,000.00 Interest Rate Maturity Date Date of Original Issue CUSIP No. 2.000% February 1, 2025 August 25, 2022 REGISTERED OWNER: CEDE & CO. PRINCIPAL AMOUNT: SEVENTEEN MILLION DOLLARS THE CITY OF EDINA, MINNESOTA (the “City”), acknowledges itself to be indebted and for value received hereby promises to pay to the registered owner named above, or registered assigns, the principal amount specified above on the maturity date specified above, and promises to pay interest thereon from the date of original issue specified above or from the most recent Interest Payment Date (as hereinafter defined) to which interest has been paid or duly provided for, at the annual interest rate specified above, payable on February 1 and August 1 in each year, commencing August 1, 2023 (each such date, an Interest Payment Date), to the person in whose name this Bond is registered at the close of business on the fifteenth day (whether or not a business day) of the immediately preceding calendar month, all subject to the provisions referred to herein with respect to the redemption of the principal of this Bond before maturity. Interest hereon shall be computed on the basis of a 360-day year composed of twelve 30-day months. The interest hereon and, upon presentation and surrender hereof at the principal office of the agent of the Registrar described below, the principal hereof are payable in lawful money of the United States of America by check or draft drawn on U.S. Bank Trust Company, National Association, St. Paul, Minnesota, as bond registrar, transfer agent and paying agent, or its successor designated under the Resolution described herein (the “Registrar”) or other agreed-upon means of payment by the Registrar. For the prompt and full payment of such principal and interest as the same respectively become due, the full faith and credit and taxing powers of the City have been and are hereby irrevocably pledged. This Bond is one of an issue (the “Bonds”) in the aggregate principal amount of $17,000,000, issued pursuant to a resolution adopted by the City Council (the “Council”) on August 3, 2022 (the “Resolution”) to provide funds to finance various improvements as identified in the City’s Capital Improvement Plan approved by the Council in accordance with Minnesota Statutes, Section 475.521, and is issued pursuant to and in full conformity with the Constitution and laws of the State of Minnesota thereunto enabling, including Minnesota Statutes, Chapter 475. The Bonds are issuable only in fully registered form, in denominations of $5,000 or any integral multiple thereof, of single maturities. 4876-2177-1303\3 3 The City has covenanted and agreed that at or prior to the maturity of the Bonds it will sell and issue its definitive bonds or additional temporary bonds pursuant to Minnesota Statutes, Section 475.61, subd. 6, in an aggregate principal amount at least sufficient to provide the amount needed, together with any other money appropriated to the debt service fund for the Bonds, to pay the principal of and interest on the Bonds due at their maturity. If the Bonds are not paid in full at maturity, the registered owners thereof shall have the right to require the City to issue and exchange, at par, new temporary bonds for the Bonds, maturing within one year from their date of issuance and bearing interest at the maximum rate permitted by law. The Bonds are subject to redemption and prepayment at the option of the City, in whole or in part, and if in part in such order of maturity dates as the City may select and by lot as selected by the Registrar (or, if applicable, by the bond depository in accordance with its customary procedures) in multiples of $5,000 as to Bonds maturing on the same date, on February 1, 2024, and any date thereafter, at a price equal to the principal amount thereof plus accrued interest to the date of redemption. Prior to the date specified for the redemption of any Bond prior to its stated maturity date, the City will cause notice of the call for redemption to be published if and as required by law, and, at least thirty days prior to the designated redemption date, will cause notice of the call to be mailed by first class mail (or, if applicable, provided in accordance with the operational arrangements of the bond depository), to the registered owner of any Bond to be redeemed at the owner’s address as it appears on the Bond Register maintained by the Registrar, but no defect in or failure to give such mailed notice of redemption shall affect the validity of proceedings for the redemption of any Bond not affected by such defect or failure. Official notice of redemption having been given as aforesaid, the Bonds or portions of Bonds so to be redeemed shall, on the redemption date, become due and payable at the redemption price therein specified, and from and after such date (unless the City shall default in the payment of the redemption price) such Bonds or portions of such Bonds shall cease to bear interest. Upon partial redemption of any Bond, a new Bond or Bonds will be delivered to the registered owner without charge, representing the remaining principal amount outstanding. The Bonds are not designated as “qualified tax-exempt obligations” for purposes of Section 265(b)(3) of the Code relating to the disallowance of interest expense for financial institutions. The City shall cause notice of the call for redemption to be published if and as required by law and, at least thirty (30) and not more than sixty (60) days prior to the date specified for redemption, will cause notice of the call thereof to be mailed, by first class mail (or, if applicable, provided in accordance with the operational arrangements of the bond depository), to the registered owner of any Bond to be redeemed at the owner’s address as it appears on the register maintained by the Registrar, but no defect in or failure to give such mailed notice of redemption shall affect the validity of proceedings for the redemption of any Bond not affected by such defect or failure. Official notice of redemption having been given as aforesaid, the Bonds or portions of Bonds so to be redeemed shall, on the redemption date, become due and payable at the redemption price therein specified, and from and after such date (unless the City shall default in the payment of the redemption price) such Bonds or portions of Bonds shall cease to bear interest. Upon partial redemption of any Bond, a new Bond or Bonds will be delivered to the registered owner without charge, representing the remaining principal amount outstanding. As provided in the Resolution and subject to certain limitations set forth therein, this Bond is transferable upon the books of the City at the principal office of the Registrar, by the registered owner hereof in person or by the owner’s attorney duly authorized in writing upon surrender hereof together with a written instrument of transfer satisfactory to the Registrar, duly executed by the registered owner or the owner’s attorney; and may also be surrendered in exchange for Bonds of other authorized denominations. Upon such transfer or exchange the City will cause a new Bond or Bonds to be issued in the name of the transferee or registered owner, of the same aggregate principal amount, bearing interest at the same rate 4876-2177-1303\3 4 and maturing on the same date, subject to reimbursement for any tax, fee or governmental charge required to be paid with respect to such transfer or exchange. The City and the Registrar may deem and treat the person in whose name this Bond is registered as the absolute owner hereof, whether this Bond is overdue or not, for the purpose of receiving payment and for all other purposes, and neither the City nor the Registrar shall be affected by any notice to the contrary. Notwithstanding any other provisions of this Bond, so long as this Bond is registered in the name of Cede & Co., as nominee of The Depository Trust Company, or in the name of any other nominee of The Depository Trust Company or other securities depository, the Registrar shall pay all principal of and interest on this Bond, and shall give all notices with respect to this Bond, only to Cede & Co. or other nominee in accordance with the operational arrangements of The Depository Trust Company or other securities depository as agreed to by the City. IT IS HEREBY CERTIFIED, RECITED, COVENANTED AND AGREED that all acts, conditions and things required by the Constitution and laws of the State of Minnesota to be done, to exist, to happen and to be performed preliminary to and in the issuance of this Bond in order to make it a valid and binding general obligation of the City in accordance with its terms, have been done, do exist, have happened and have been performed as so required; that, prior to the issuance hereof, the City has established its General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B Bond Fund and has appropriated thereto such capitalized interest and proceeds of definitive bonds as will be sufficient to produce sums not less than five percent in excess of the principal of and interest on the Bonds when due; that if necessary for payment of such principal and interest, ad valorem taxes are required to be levied upon all taxable property in the City, without limitation as to rate or amount; that all proceedings relative to the improvements financed by this Bond have been or will be taken according to law and that the issuance of this Bond, together with all other indebtedness of the City outstanding on the date hereof and on the date of its actual issuance and delivery, does not cause the indebtedness of the City to exceed any constitutional or statutory limitation of indebtedness. This Bond shall not be valid or become obligatory for any purpose or be entitled to any security or benefit under the Resolution until the Certificate of Authentication hereon shall have been executed by the Registrar by manual signature of one of its authorized representatives. 4876-2177-1303\3 5 IN WITNESS WHEREOF, the City of Edina, Minnesota, by its City Council, has caused this Bond to be executed on its behalf by the facsimile signatures of the Mayor and City Manager and has caused this Bond to be dated as of the date set forth below. CITY OF EDINA, MINNESOTA (facsimile signature - City Manager) (facsimile signature - Mayor) _______________ CERTIFICATE OF AUTHENTICATION This is one of the Bonds delivered pursuant to the Resolution mentioned within. Date of Authentication: _________________ U.S. BANK TRUST COMPANY, NATIONAL ASSOCIATION, as Registrar By Authorized Representative _______________ 4876-2177-1303\3 6 The following abbreviations, when used in the inscription on the face of this Obligation, shall be construed as though they were written out in full according to the applicable laws or regulations: TEN COM --as tenants in common UTMA ………….…. as Custodian for ………….….. (Cust) (Minor) TEN ENT --as tenants by the entireties under Uniform Transfers to Minors Act ...................…….. (State) JT TEN --as joint tenants with right of survivorship and not as tenants in common Additional abbreviations may also be used. _______________ ASSIGNMENT For value received, the undersigned hereby sells, assigns and transfers unto ________________________________________________________ the within Obligation and all rights thereunder, and does hereby irrevocably constitute and appoint _____________________________________________________ attorney to transfer the said Obligation on the books kept for registration of the within Obligation, with full power of substitution in the premises. Dated: NOTICE: The assignor's signature to this assignment must correspond with the name as it appears upon the face of the within Bond in every particular, without alteration or enlargement or any change whatsoever. Signature Guaranteed: Signature(s) must be guaranteed by an "eligible guarantor institution" meeting the requirements of the Registrar, which requirements include membership or participation in STAMP or such other "signature guaranty program" as may be determined by the Registrar in addition to or in substitution for STAMP, all in accordance with the Securities Exchange Act of 1934, as amended. PLEASE INSERT SOCIAL SECURITY OR OTHER IDENTIFYING NUMBER OF ASSIGNEE: 4876-2177-1303\3 HENNEPIN COUNTY AUDITOR’S CERTIFICATE AS TO REGISTRATION The undersigned, being the duly qualified and acting County Auditor of Hennepin County, Minnesota, hereby certifies that there has been filed in my office a certified copy of a resolution duly adopted on August 3, 2022, by the City Council of the City of Edina, Minnesota, setting forth the form and details of an issue of $17,000,000 General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B, dated as of August 25, 2022. I further certify that the issue has been entered on my bond register as required by Minnesota Statutes, Section 475.62 through 475.63. WITNESS my hand and official seal this _____ day of _____________, 2022. Hennepin County Auditor / Treasurer (SEAL) Rating Action: Moody's assigns Aaa to Edina, MN's GO bonds 28 Jul 2022 New York, July 28, 2022 -- Moody's Investors Service has assigned a Aaa rating to the City of Edina, MN's $17 million General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B. Moody's maintains the Aaa rating on the city's outstanding general obligation unlimited tax (GOULT) debt. Following the sale, the city will have approximately $118 million total debt outstanding. RATINGS RATIONALE The Aaa rating reflects the city's growing, affluent tax base in the Minneapolis (Aa1 stable)-St. Paul (Aa1 stable) metropolitan area and robust financial position. These credit strengths are balanced against the city's elevated leverage and fixed costs. RATING OUTLOOK Moody's does not typically assign outlooks to local governments with this amount of debt. FACTORS THAT COULD LEAD TO AN UPGRADE OF THE RATING - Not applicable FACTORS THAT COULD LEAD TO A DOWNGRADE OF THE RATING - Material tax base contraction coupled with weakened resident income - Significant, sustained narrowing of operating reserves LEGAL SECURITY Outstanding GOULT bonds, including the current issuance, are backed by the city's full faith and credit pledge and the authority to levy a dedicated property tax unlimited as to rate and amount. The GOULT bonds are additionally secured by statute. USE OF PROCEEDS The bonds will finance land acquisition and design costs for a fire station. PROFILE Edina encompasses about 17 square miles in Hennepin County (Aaa stable), just southwest of Minneapolis. The city provides general government services, public safety, public works, parks and recreation services, municipal utilities and a golf course to over 52,000 residents. METHODOLOGY The principal methodology used in this rating was US Local Government General Obligation Debt published in January 2021 and available at https://ratings.moodys.com/api/rmc-documents/70015 . Alternatively, please see the Rating Methodologies page on https://ratings.moodys.com for a copy of this methodology. REGULATORY DISCLOSURES For further specification of Moody's key rating assumptions and sensitivity analysis, see the sections Methodology Assumptions and Sensitivity to Assumptions in the disclosure form. Moody's Rating Symbols and Definitions can be found on https://ratings.moodys.com/rating-definitions. For ratings issued on a program, series, category/class of debt or security this announcement provides certain regulatory disclosures in relation to each rating of a subsequently issued bond or note of the same series, category/class of debt, security or pursuant to a program for which the ratings are derived exclusively from existing ratings in accordance with Moody's rating practices. For ratings issued on a support provider, this announcement provides certain regulatory disclosures in relation to the credit rating action on the support provider and in relation to each particular credit rating action for securities that derive their credit ratings from the support provider's credit rating. For provisional ratings, this announcement provides certain regulatory disclosures in relation to the provisional rating assigned, and in relation to a definitive rating that may be assigned subsequent to the final issuance of the debt, in each case where the transaction structure and terms have not changed prior to the assignment of the definitive rating in a manner that would have affected the rating. For further information please see the issuer/deal page for the respective issuer on https://ratings.moodys.com. Regulatory disclosures contained in this press release apply to the credit rating and, if applicable, the related rating outlook or rating review. Moody's general principles for assessing environmental, social and governance (ESG) risks in our credit analysis can be found at https://ratings.moodys.com/documents/PBC_1288235. Please see https://ratings.moodys.com for any updates on changes to the lead rating analyst and to the Moody's legal entity that has issued the rating. Please see the issuer/deal page on https://ratings.moodys.com for additional regulatory disclosures for each credit rating. Isabella Romano Lead Analyst REGIONAL_MIDWEST Moody's Investors Service, Inc. 100 N Riverside Plaza Suite 2220 Chicago 60606 JOURNALISTS: 1 212 553 0376 Client Service: 1 212 553 1653 Nicolanne Serrano Additional Contact REGIONAL_NE JOURNALISTS: 1 212 553 0376 Client Service: 1 212 553 1653 Releasing Office: Moody's Investors Service, Inc. 250 Greenwich Street New York, NY 10007 U.S.A JOURNALISTS: 1 212 553 0376 Client Service: 1 212 553 1653 © 2022 Moody’s Corporation, Moody’s Investors Service, Inc., Moody’s Analytics, Inc. and/or their licensors and affiliates (collectively, “MOODY’S”). All rights reserved. CREDIT RATINGS ISSUED BY MOODY'S CREDIT RATINGS AFFILIATES ARE THEIR CURRENT OPINIONS OF THE RELATIVE FUTURE CREDIT RISK OF ENTITIES, CREDIT COMMITMENTS, OR DEBT OR DEBT-LIKE SECURITIES, AND MATERIALS, PRODUCTS, SERVICES AND INFORMATION PUBLISHED BY MOODY’S (COLLECTIVELY, “PUBLICATIONS”) MAY INCLUDE SUCH CURRENT OPINIONS. MOODY’S DEFINES CREDIT RISK AS THE RISK THAT AN ENTITY MAY NOT MEET ITS CONTRACTUAL FINANCIAL OBLIGATIONS AS THEY COME DUE AND ANY ESTIMATED FINANCIAL LOSS IN THE EVENT OF DEFAULT OR IMPAIRMENT. SEE APPLICABLE MOODY’S RATING SYMBOLS AND DEFINITIONS PUBLICATION FOR INFORMATION ON THE TYPES OF CONTRACTUAL FINANCIAL OBLIGATIONS ADDRESSED BY MOODY’S CREDIT RATINGS. CREDIT RATINGS DO NOT ADDRESS ANY OTHER RISK, INCLUDING BUT NOT LIMITED TO: LIQUIDITY RISK, MARKET VALUE RISK, OR PRICE VOLATILITY. CREDIT RATINGS, NON-CREDIT ASSESSMENTS (“ASSESSMENTS”), AND OTHER OPINIONS INCLUDED IN MOODY’S PUBLICATIONS ARE NOT STATEMENTS OF CURRENT OR HISTORICAL FACT. MOODY’S PUBLICATIONS MAY ALSO INCLUDE QUANTITATIVE MODEL-BASED ESTIMATES OF CREDIT RISK AND RELATED OPINIONS OR COMMENTARY PUBLISHED BY MOODY’S ANALYTICS, INC. AND/OR ITS AFFILIATES. MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS AND PUBLICATIONS DO NOT CONSTITUTE OR PROVIDE INVESTMENT OR FINANCIAL ADVICE, AND MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS AND PUBLICATIONS ARE NOT AND DO NOT PROVIDE RECOMMENDATIONS TO PURCHASE, SELL, OR HOLD PARTICULAR SECURITIES. MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS AND PUBLICATIONS DO NOT COMMENT ON THE SUITABILITY OF AN INVESTMENT FOR ANY PARTICULAR INVESTOR. MOODY’S ISSUES ITS CREDIT RATINGS, ASSESSMENTS AND OTHER OPINIONS AND PUBLISHES ITS PUBLICATIONS WITH THE EXPECTATION AND UNDERSTANDING THAT EACH INVESTOR WILL, WITH DUE CARE, MAKE ITS OWN STUDY AND EVALUATION OF EACH SECURITY THAT IS UNDER CONSIDERATION FOR PURCHASE, HOLDING, OR SALE. MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS, AND PUBLICATIONS ARE NOT INTENDED FOR USE BY RETAIL INVESTORS AND IT WOULD BE RECKLESS AND INAPPROPRIATE FOR RETAIL INVESTORS TO USE MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS OR PUBLICATIONS WHEN MAKING AN INVESTMENT DECISION. IF IN DOUBT YOU SHOULD CONTACT YOUR FINANCIAL OR OTHER PROFESSIONAL ADVISER. ALL INFORMATION CONTAINED HEREIN IS PROTECTED BY LAW, INCLUDING BUT NOT LIMITED TO, COPYRIGHT LAW, AND NONE OF SUCH INFORMATION MAY BE COPIED OR OTHERWISE REPRODUCED, REPACKAGED, FURTHER TRANSMITTED, TRANSFERRED, DISSEMINATED, REDISTRIBUTED OR RESOLD, OR STORED FOR SUBSEQUENT USE FOR ANY SUCH PURPOSE, IN WHOLE OR IN PART, IN ANY FORM OR MANNER OR BY ANY MEANS WHATSOEVER, BY ANY PERSON WITHOUT MOODY’S PRIOR WRITTEN CONSENT. MOODY’S CREDIT RATINGS, ASSESSMENTS, OTHER OPINIONS AND PUBLICATIONS ARE NOT INTENDED FOR USE BY ANY PERSON AS A BENCHMARK AS THAT TERM IS DEFINED FOR REGULATORY PURPOSES AND MUST NOT BE USED IN ANY WAY THAT COULD RESULT IN THEM BEING CONSIDERED A BENCHMARK. All information contained herein is obtained by MOODY’S from sources believed by it to be accurate and reliable. Because of the possibility of human or mechanical error as well as other factors, however, all information contained herein is provided “AS IS” without warranty of any kind. MOODY'S adopts all necessary measures so that the information it uses in assigning a credit rating is of sufficient quality and from sources MOODY'S considers to be reliable including, when appropriate, independent third-party sources. However, MOODY’S is not an auditor and cannot in every instance independently verify or validate information received in the rating process or in preparing its Publications. To the extent permitted by law, MOODY’S and its directors, officers, employees, agents, representatives, licensors and suppliers disclaim liability to any person or entity for any indirect, special, consequential, or incidental losses or damages whatsoever arising from or in connection with the information contained herein or the use of or inability to use any such information, even if MOODY’S or any of its directors, officers, employees, agents, representatives, licensors or suppliers is advised in advance of the possibility of such losses or damages, including but not limited to: (a) any loss of present or prospective profits or (b) any loss or damage arising where the relevant financial instrument is not the subject of a particular credit rating assigned by MOODY’S. To the extent permitted by law, MOODY’S and its directors, officers, employees, agents, representatives, licensors and suppliers disclaim liability for any direct or compensatory losses or damages caused to any person or entity, including but not limited to by any negligence (but excluding fraud, willful misconduct or any other type of liability that, for the avoidance of doubt, by law cannot be excluded) on the part of, or any contingency within or beyond the control of, MOODY’S or any of its directors, officers, employees, agents, representatives, licensors or suppliers, arising from or in connection with the information contained herein or the use of or inability to use any such information. NO WARRANTY, EXPRESS OR IMPLIED, AS TO THE ACCURACY, TIMELINESS, COMPLETENESS, MERCHANTABILITY OR FITNESS FOR ANY PARTICULAR PURPOSE OF ANY CREDIT RATING, ASSESSMENT, OTHER OPINION OR INFORMATION IS GIVEN OR MADE BY MOODY’S IN ANY FORM OR MANNER WHATSOEVER. Moody’s Investors Service, Inc., a wholly-owned credit rating agency subsidiary of Moody’s Corporation (“MCO”), hereby discloses that most issuers of debt securities (including corporate and municipal bonds, debentures, notes and commercial paper) and preferred stock rated by Moody’s Investors Service, Inc. have, prior to assignment of any credit rating, agreed to pay to Moody’s Investors Service, Inc. for credit ratings opinions and services rendered by it fees ranging from $1,000 to approximately $5,000,000. MCO and Moody’s Investors Service also maintain policies and procedures to address the independence of Moody’s Investors Service credit ratings and credit rating processes. Information regarding certain affiliations that may exist between directors of MCO and rated entities, and between entities who hold credit ratings from Moody’s Investors Service and have also publicly reported to the SEC an ownership interest in MCO of more than 5%, is posted annually at www.moodys.com under the heading “Investor Relations — Corporate Governance — Director and Shareholder Affiliation Policy.” Additional terms for Australia only: Any publication into Australia of this document is pursuant to the Australian Financial Services License of MOODY’S affiliate, Moody’s Investors Service Pty Limited ABN 61 003 399 657AFSL 336969 and/or Moody’s Analytics Australia Pty Ltd ABN 94 105 136 972 AFSL 383569 (as applicable). This document is intended to be provided only to “wholesale clients” within the meaning of section 761G of the Corporations Act 2001. By continuing to access this document from within Australia, you represent to MOODY’S that you are, or are accessing the document as a representative of, a “wholesale client” and that neither you nor the entity you represent will directly or indirectly disseminate this document or its contents to “retail clients” within the meaning of section 761G of the Corporations Act 2001. MOODY’S credit rating is an opinion as to the creditworthiness of a debt obligation of the issuer, not on the equity securities of the issuer or any form of security that is available to retail investors. Additional terms for Japan only: Moody's Japan K.K. (“MJKK”) is a wholly-owned credit rating agency subsidiary of Moody's Group Japan G.K., which is wholly-owned by Moody’s Overseas Holdings Inc., a wholly-owned subsidiary of MCO. Moody’s SF Japan K.K. (“MSFJ”) is a wholly-owned credit rating agency subsidiary of MJKK. MSFJ is not a Nationally Recognized Statistical Rating Organization (“NRSRO”). Therefore, credit ratings assigned by MSFJ are Non-NRSRO Credit Ratings. Non-NRSRO Credit Ratings are assigned by an entity that is not a NRSRO and, consequently, the rated obligation will not qualify for certain types of treatment under U.S. laws. MJKK and MSFJ are credit rating agencies registered with the Japan Financial Services Agency and their registration numbers are FSA Commissioner (Ratings) No. 2 and 3 respectively. MJKK or MSFJ (as applicable) hereby disclose that most issuers of debt securities (including corporate and municipal bonds, debentures, notes and commercial paper) and preferred stock rated by MJKK or MSFJ (as applicable) have, prior to assignment of any credit rating, agreed to pay to MJKK or MSFJ (as applicable) for credit ratings opinions and services rendered by it fees ranging from JPY100,000 to approximately JPY550,000,000. MJKK and MSFJ also maintain policies and procedures to address Japanese regulatory requirements. Summary: Edina, Minnesota; General Obligation Primary Credit Analyst: Jessica Olejak, Chicago + 1 (312) 233 7068; jessica.olejak@spglobal.com Secondary Contact: Vanessa M Martinez, New York + 1 (212) 438 1415; vanessa.martinez@spglobal.com Table Of Contents Rating Action Stable Outlook Credit Opinion Related Research WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 1 Summary: Edina, Minnesota; General Obligation Credit Profile US$17.0 mil GO temp cap imp plan bnds ser 2022B dtd 08/25/2022 due 02/01/2025 Long Term Rating AAA/Stable New Rating Action S&P Global Ratings assigned its 'AAA' long-term rating to Edina, Minn.'s $17.0 million series 2022B general obligation (GO) temporary capital improvement plan bonds. The outlook is stable. The city's unlimited-tax, full-faith-and-credit GO pledge secures the bonds. The bonds will be used for the initial financing of the site acquisition and design for the city's Fire Station No. 2 project. There will be at least one more issuance to complete this project. The city intends to retire the 2022B and any subsequent bonds issued for the fire station's construction, with the issuance of up to 30-year bonds. The bonds have more than two years' maturity; we consider the city's internal liquidity available to retire these bonds and its future market access within our long-term rating analysis. Edina's GO bonds are eligible to be rated above the sovereign because we believe the city can maintain better credit characteristics than the U.S. in a stress scenario. Under our criteria, "Ratings Above The Sovereign--Corporate And Government Ratings: Methodology And Assumptions," published Nov. 19, 2013, on RatingsDirect, U.S. local governments are considered to have moderate sensitivity to country risk. The institutional framework in the U.S. is predictable for local governments, allowing them significant autonomy and independent treasury management, with no history of federal government intervention. We believe Edina's financial flexibility is sufficiently demonstrated by its very strong budgetary reserves and liquidity. Credit overview With the issuances of the bonds and the potential issuances over the next two-and-a-half years, the city would almost double its debt burden, possibly to a level that we consider weak to very weak. We do not believe this will materially weaken Edina's overall credit quality, given it has numerous other strengths, including a diverse economy that is independently strong but also part of a broad and diverse metropolitan statistical area, consistently stable financial operating results with no discernible budgetary pressures, and a sophisticated and knowledgeable management team. Residential demand remains extremely strong, which contributes to strong tax base growth and is an inherent credit strength that distinguishes the city even among other highly rated Twin Cities-area suburban municipalities. The rating reflects our assessment of the following factors for Edina, specifically its: • Very strong and growing economy, with a $14 billion tax base and per capita wealth and income that compare favorably with those of 'AAA'-rated peers; • Strong financial profile, with a consistent record of positive operating results and reserves that are very high; WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 2 • Strong financial policies and practices under our Financial Management Assessment (FMA) methodology, and a strong institutional framework; and • Weakening debt burden, with the city's overall debt profile growing this year, potentially significantly if the voters approve the local option sales tax bonds, but we do not believe this would pressure the budget. Environmental, social, and governance Environmental, social, and governance factors generally are credit neutral within our analysis. An exception is the city's high housing costs, which we view as a form of social capital risk, because lack of affordability could increasingly become a drag on economic growth. To address this challenge, the city now requires developers of multifamily housing to designate a portion of new construction to be rented or sold at below-market rates, and plans to develop affordable housing itself. Stable Outlook Downside scenario Although unlikely given Edina's strong financial profile and forward planning, we could take a negative rating action if the city's financial performance were to materially worsen as a result of issuing the anticipated sales tax debt, or if revenue performance weakens unexpectedly. Credit Opinion Very strong economy likely to continue growing at a rapid pace Edina remains one of the Twin Cities' premier wealthy inner-ring suburbs. Despite being fully built out, the city has seen substantial growth over the past six years, as residents and business owners tear down and replace older homes and buildings with new construction or remodel existing structures. Residential teardowns persisted, along with $215 million of new apartment construction, boosting permit revenue in 2021 and adding to the ever-growing tax base. Residential properties make up a majority of the tax base (64%), followed by commercial and industrial (27%). With increasing housing demand in Edina, there are more than 800 apartment units under construction, with additional plans for a 23-story luxury apartment high-rise, an eight-story office building, and a 240-room Marriott hotel. Southdale Mall, the oldest climate-controlled shopping center in the country, shows ongoing resiliency as it continues to shift from a traditional indoor mall to include high-end stand-alone retail stores, a large fitness center, and luxury apartments around the perimeter of the property. The Southdale area properties total less than 5% of total market value, illustrating the diversity of properties and lack of tax base concentration in the city. Very strong management with forward-looking practices The city council has adopted a detailed two-year budget and maintains a six-year capital improvement plan that is updated every two years and identifies sources and uses of funds. The council reviews budget-to-actual results, along with investment holdings, quarterly. Edina meets its policy to maintain an unassigned general fund balance at 42%-47% of the subsequent year's budgeted tax revenue. When the unassigned fund balance falls below or exceeds this range, the city council either creates a plan to restore fund balance or considers transferring the excess to other WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 3 Summary: Edina, Minnesota; General Obligation funds. The city also has its own debt management and investment policies. Edina's finances remained very strong and resilient throughout the COVID-19 pandemic and into 2022 The budget for 2022, the first year of the city's two-year budget cycle, is structurally break-even without any transfers in. On the revenue side, the budget includes a 8% levy increase (2% of this is for streets, which will be increasingly paid from the levy and not the historical method of special assessments). On the expenditure side, the budget includes a 2% salary increase for cost-of-living adjustments and increases in some service levels, including information technology and data practices, and election security. The city received the remaining $2.5 million (of the $4.9 million) in federal stimulus revenue from the American Rescue Plan Act, which will likely be spent this year, although council has not approved this. Given Edina's history of outperforming its budget and management's observing slightly better-than-budgeted actuals, we expect the city will generate another operating surplus in 2022. Fiscal 2021 results show the general fund decreased by $4 million, spurred by a transfer out of the previous year's surplus to the construction fund, which we removed for our analysis. The city's primary revenue sources are property taxes (62%), licenses and permits (12%), and charges for services (9%). The city's recreation-related facilities--including the arts center, aquatic center, and arena--performed better in 2021, with collective almost break-even results before transfers in. Available fund balance continues to grow, maintaining very strong reserves and liquidity The available fund balance includes $23.6 million in the general fund, $25.7 million of assigned reserves in the construction fund, and $2.5 million in cash in the liquor enterprise fund. The construction fund has been increasing each year, and while it is assigned for capital purposes (such as equipment and vehicles), it can be reassigned for general operations at any time without restrictions. We expect the city will continue to meet its reserve policy, given its longstanding trend of operational surpluses. Although it is not an immediate stress on the city's liquidity position, Edina is engaged in a pending civil lawsuit stemming from an officer-involved shooting that occurred in September 2019. The city's financial exposure is currently unknown, although management anticipates any potential costs would likely be covered by insurance. The city privately placed a $3 million GO bond in 2020; we have reviewed the terms and do not consider this obligation to represent a material contingent liquidity risk. Significantly increasing debt burden, magnitude to be determined by voters this fall In addition to Edina's annual $4 million-$6 million of annual GO bonds, the city will issue up to $22 million in GO bonds over the next two years for the remaining costs of constructing the new fire station. The city will go to voters to seek approval of an additional $39 million of bonding authority to be repaid by a new local option sales tax, although the bonds would also carry the GO pledge. If those measures pass, depending on the size, timing, and structure of the bonds, we believe the city's debt burden will likely be weak to very weak over the next two years, as the overall debt burden could almost double. The local option sales tax debt would be used to finance two park spaces. The first is the transformation of the closed 42-acre Fred Richards golf course into a park with mostly natural features and recreational amenities. Officials said WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 4 Summary: Edina, Minnesota; General Obligation that along with use by residents, they hope to attract private business development of a vacant office park beside the area. The city will also renovate and expand facilities and amenities within the 500-acre Braemar park, which has many athletic facilities, including a golf course and ice arena. No enterprise revenue would be used to repay debt service. Manageable pension burden The city participates in two cost-sharing, multiple-employer, defined-benefit pension plans, the General Employees Retirement Fund (GERF) and the Public Employees Police and Fire Fund (PEPFF), both administered by the Public Employees Retirement Assn. of Minnesota (PERA). Required pension contributions to these plans are determined by state statute. Statutory contributions rates have generally not kept pace with actuarially determined contribution (ADC) rates, indicating potential for future payment acceleration. In May 2018, the state passed pension legislation that will marginally increase contributions (for PEPFF only), reduce the investment rate of return to 7.5% (from 8%), and reduce some employee benefits (primarily cost-of-living adjustments). While we view these as positive changes for future plan funding levels, the lack of an actuarial funding policy remains a weakness in these plans. The GERF and PEPFF were 87% and 93% funded, respectively, in fiscal 2021. The combined net pension liabilities for these plans totaled $19 million in fiscal 2021, the most recent year of data available for the city's proportionate share. The city is legally required to include any retirees in the same insurance pool as its active employees, but the retirees pay the premiums, resulting in an implicit rate subsidy. The city funds its other postemployment benefits on a pay-as-you-go basis. As of Jan. 1, 2020, the most recent actuarial valuation date, the city's unfunded actuarial accrued liability was $2.5 million. Strong institutional framework The institutional framework score for Minnesota cities with populations greater than 2,500 is strong. Edina, Minnesota--Key Credit Metrics Most recent Historical information 2021 2020 2019 Very strong economy Projected per capita EBI % of U.S.200 Market value per capita ($)264,025 Population 53,318 52,442 51,935 County unemployment rate(%)3.4 Market value ($000)14,077,303 13,565,134 12,966,365 Ten largest taxpayers % of taxable value 7.3 Strong budgetary performance Operating fund result % of expenditures 1.7 12.3 4.9 Total governmental fund result % of expenditures 3.1 20.0 3.1 Very strong budgetary flexibility Available reserves % of operating expenditures 104.2 105.7 98.6 Total available reserves ($000)51,259 48,653 42,195 WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 5 Summary: Edina, Minnesota; General Obligation Edina, Minnesota--Key Credit Metrics (cont.) Most recent Historical information 2021 2020 2019 Very strong liquidity Total government cash % of governmental fund expenditures 166 168 150 Total government cash % of governmental fund debt service 1166 1465 1301 Very strong management Financial Management Assessment Strong Adequate debt & long-term liabilities Debt service % of governmental fund expenditures 14.2 11.5 11.6 Net direct debt % of governmental fund revenue 130 Overall net debt % of market value 2.9 Direct debt 10-year amortization (%)80 Required pension contribution % of governmental fund expenditures 4.8 OPEB actual contribution % of governmental fund expenditures 0.1 Strong institutional framework EBI--Effective buying income. OPEB--Other postemployment benefits. Data points and ratios may reflect analytical adjustments. Related Research • Through The ESG Lens 3.0: The Intersection Of ESG Credit Factors And U.S. Public Finance Credit Factors, March 2, 2022 • 2021 Update Of Institutional Framework For U.S. Local Governments Certain terms used in this report, particularly certain adjectives used to express our view on rating relevant factors, have specific meanings ascribed to them in our criteria, and should therefore be read in conjunction with such criteria. Please see Ratings Criteria at www.standardandpoors.com for further information. Complete ratings information is available to subscribers of RatingsDirect at www.capitaliq.com. All ratings affected by this rating action can be found on S&P Global Ratings' public website at www.standardandpoors.com. Use the Ratings search box located in the left column. WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 6 Summary: Edina, Minnesota; General Obligation WWW.STANDARDANDPOORS.COM/RATINGSDIRECT JULY 29, 2022 7 STANDARD & POOR’S, S&P and RATINGSDIRECT are registered trademarks of Standard & Poor’s Financial Services LLC. S&P may receive compensation for its ratings and certain analyses, normally from issuers or underwriters of securities or from obligors. S&P reserves the right to disseminate its opinions and analyses. S&P's public ratings and analyses are made available on its Web sites, www.standardandpoors.com (free of charge), and www.ratingsdirect.com (subscription), and may be distributed through other means, including via S&P publications and third-party redistributors. Additional information about our ratings fees is available at www.standardandpoors.com/usratingsfees. S&P keeps certain activities of its business units separate from each other in order to preserve the independence and objectivity of their respective activities. As a result, certain business units of S&P may have information that is not available to other S&P business units. S&P has established policies and procedures to maintain the confidentiality of certain non-public information received in connection with each analytical process. To the extent that regulatory authorities allow a rating agency to acknowledge in one jurisdiction a rating issued in another jurisdiction for certain regulatory purposes, S&P reserves the right to assign, withdraw or suspend such acknowledgment at any time and in its sole discretion. S&P Parties disclaim any duty whatsoever arising out of the assignment, withdrawal or suspension of an acknowledgment as well as any liability for any damage alleged to have been suffered on account thereof. Credit-related and other analyses, including ratings, and statements in the Content are statements of opinion as of the date they are expressed and not statements of fact. S&P’s opinions, analyses and rating acknowledgment decisions (described below) are not recommendations to purchase, hold, or sell any securities or to make any investment decisions, and do not address the suitability of any security. S&P assumes no obligation to update the Content following publication in any form or format. The Content should not be relied on and is not a substitute for the skill, judgment and experience of the user, its management, employees, advisors and/or clients when making investment and other business decisions. S&P does not act as a fiduciary or an investment advisor except where registered as such. While S&P has obtained information from sources it believes to be reliable, S&P does not perform an audit and undertakes no duty of due diligence or independent verification of any information it receives. Rating- related publications may be published for a variety of reasons that are not necessarily dependent on action by rating committees, including, but not limited to, the publication of a periodic update on a credit rating and related analyses. No content (including ratings, credit-related analyses and data, valuations, model, software or other application or output therefrom) or any part thereof (Content) may be modified, reverse engineered, reproduced or distributed in any form by any means, or stored in a database or retrieval system, without the prior written permission of Standard & Poor’s Financial Services LLC or its affiliates (collectively, S&P). The Content shall not be used for any unlawful or unauthorized purposes. S&P and any third-party providers, as well as their directors, officers, shareholders, employees or agents (collectively S&P Parties) do not guarantee the accuracy, completeness, timeliness or availability of the Content. S&P Parties are not responsible for any errors or omissions (negligent or otherwise), regardless of the cause, for the results obtained from the use of the Content, or for the security or maintenance of any data input by the user. The Content is provided on an “as is” basis. S&P PARTIES DISCLAIM ANY AND ALL EXPRESS OR IMPLIED WARRANTIES, INCLUDING, BUT NOT LIMITED TO, ANY WARRANTIES OF MERCHANTABILITY OR FITNESS FOR A PARTICULAR PURPOSE OR USE, FREEDOM FROM BUGS, SOFTWARE ERRORS OR DEFECTS, THAT THE CONTENT’S FUNCTIONING WILL BE UNINTERRUPTED OR THAT THE CONTENT WILL OPERATE WITH ANY SOFTWARE OR HARDWARE CONFIGURATION. In no event shall S&P Parties be liable to any party for any direct, indirect, incidental, exemplary, compensatory, punitive, special or consequential damages, costs, expenses, legal fees, or losses (including, without limitation, lost income or lost profits and opportunity costs or losses caused by negligence) in connection with any use of the Content even if advised of the possibility of such damages. Copyright © 2022 by Standard & Poor’s Financial Services LLC. All rights reserved. The CITY ofEDINAThe CITY ofEDINA General Obligation Bonds, Series 2022B Competitive Sale Results Summary The CITY ofEDINABond Authorization www.EdinaMN.gov 2 Purpose:Tax -exempt financing to fund $17MM in land acquisition, financing and design for the Health and Safety Center facility project Temporary Bonds: Issued for maturity in 2025 -Capitalized interest to cover interim payments -Anticipated to be wrapped into permanent financing once the design and project construction is underway The CITY ofEDINACredit Ratings History •Moody’s Investor Services Aaa since 2000 •S&P Global Ratings AAA since 2003 •Discussed financial health, local economy and future budgetary and capital plans •Both affirmed the City’s credit rating •No changes from June ‘22 evaluations www.EdinaMN.gov 3 The CITY ofEDINA2022B Bond Sale www.EdinaMN.gov 4 Number of Bids:Five Indicated Rate Spread Morgan Stanley & Co, LLC 2.1291%0.5682% Citigroup Global Markets, Inc.2.4582% Baird 2.4582% Piper Sandler & Co.2.6050%Interest Northland Securities, Inc.2.6973%Difference $234,346 The CITY ofEDINAFinal Results •Final Principal: $17,000,000 Delivers $16.84 million in net bond proceeds for project $487k set aside as capitalized interest Facilitates land acquisition expense and sets aside funds for initial design •2022B Bonds Final Calculated True Interest Cost of 2.129% www.EdinaMN.gov 5 The CITY ofEDINACouncil Consideration •Resolution Authorizing Issuance, Awarding Sale, Prescribing the Form and Details and Providing for the Payment of $17,000,000 General Obligation Bonds, Series 2022B •Prepared by Bond Attorneys at Dorsey & Whitney •-Awards the purchase of bonds to Morgan Stanley & Co, LLC Reflects terms from the lowest cost proposal received Establishes the final sizing and repayment schedule Closing scheduled for August 25, 2022 www.EdinaMN.gov 6 Sale Day Report for City of Edina, Minnesota 1 • • • • BID TABULATION $17,000,000 General Obligation Temporary Capital Improvement Plan Bonds, Series 2022B City of Edina, Minnesota SALE: August 3, 2022 AWARD: MORGAN STANLEY & CO, LLC Rating: Moody's Investor's Service "Aaa" S&P Global Ratings "AAA" Tax Exempt - Non-Bank Qualified NAME OF BIDDER MATURITY (February 1) RATE REOFFERING YIELD PRICE NET INTEREST COST TRUE INTEREST RATE MORGAN STANLEY & CO, LLC $16,946,762.36 $880,570.97 2.1291% New York, New York 2025 2.000% 2.100% Raymond James & Associates, Inc. FHN Financial Capital Markets UBS Financial Services Inc. Ramirez & Co., Inc. Ziegler Alamo Capital WMBE R. Seelaus & Co., LLC WMBE American Veterans Group, PBC SDVOB CITIGROUP GLOBAL MARKETS INC. $16,915,000.00 $1,015,750.00 2.4582% Los Angeles, California BAIRD $16,915,000.00 $1,015,750.00 2.4582% Milwaukee, Wisconsin PIPER SANDLER & CO. $17,154,700.00 $1,086,300.00 2.6050% Minneapolis, Minnesota NORTHLAND SECURITIES, INC. $16,919,250.00 $1,114,916.67 2.6973% Minneapolis, Minnesota City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Sources & Uses Dated 08/25/2022 | Delivered 08/25/2022 Sources Of Funds Par Amount of Bonds $17,000,000.00 Original Issue Discount (OID)(40,290.00) Total Sources $16,959,710.00 Uses Of Funds Total Underwriter's Discount (0.076%)12,947.64 Costs of Issuance 101,800.00 Deposit to Capitalized Interest (CIF) Fund 487,333.33 Deposit to Project Fund 16,357,629.03 Total Uses $16,959,710.00 Series 2022B GO Temp CIP | SINGLE PURPOSE | 8/ 3/2022 | 10:18 AM City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Debt Service Schedule Date Principal Coupon Interest Total P+I Fiscal Total 08/25/2022 ----- 08/01/2023 --317,333.33 317,333.33 - 02/01/2024 --170,000.00 170,000.00 487,333.33 08/01/2024 --170,000.00 170,000.00 - 02/01/2025 17,000,000.00 2.000%170,000.00 17,170,000.00 17,340,000.00 Total $17,000,000.00 -$827,333.33 $17,827,333.33 - Yield Statistics Bond Year Dollars $41,366.67 Average Life 2.433 Years Average Coupon 2.0000000% Net Interest Cost (NIC)2.1286969% True Interest Cost (TIC)2.1291663% Bond Yield for Arbitrage Purposes 2.0968905% All Inclusive Cost (AIC)2.3839832% IRS Form 8038 Net Interest Cost 2.1023799% Weighted Average Maturity 2.433 Years Series 2022B GO Temp CIP | SINGLE PURPOSE | 8/ 3/2022 | 10:18 AM City of Edina, Minnesota $17,000,000 General Obligation Temporary CIP Bonds, Series 2022B Net Debt Service Schedule Date Principal Coupon Interest Total P+I CIF Net New D/S Fiscal Total 08/25/2022 ------- 08/01/2023 --317,333.33 317,333.33 (317,333.33)-- 02/01/2024 --170,000.00 170,000.00 (170,000.00)-- 08/01/2024 --170,000.00 170,000.00 -170,000.00 - 02/01/2025 17,000,000.00 2.000%170,000.00 17,170,000.00 -17,170,000.00 17,340,000.00 Total $17,000,000.00 -$827,333.33 $17,827,333.33 (487,333.33)$17,340,000.00 - Series 2022B GO Temp CIP | SINGLE PURPOSE | 8/ 3/2022 | 10:18 AM Date: August 3, 2022 Agenda Item #: VIII.F. To:Mayor and City Council Item Type: Report / Recommendation From:Cary Teague, Community Development Director Item Activity: Subject:Ordinance No. 2021-07: Off-Street Parking Regulations Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Grant first reading of Ordinance No. 2021-07 amendment regarding off-street parking regulations. OR, Grant first reading of Ordinance No. 2021-07 amendment regarding off-street parking regulations, and waive second reading. INTRODUCTION: As directed by the City Council at the April work session with the Planning Commission, attached is the proposed ordinance amendment regarding off-street parking regulations. This ordinance is the first step in the Planning Commissions work plan item to address parking regulations in the City of Edina. The City’s current regulations have not been revised since 1992. Many of the current standards have not been amended since 1970. If Council is comfortable with the proposed language, you may waive second reading and adopt the Ordinance as written. If changes are recommended, staff will draft those changes in the ordinance, and bring back to City Council for second reading on August 16. ATTACHMENTS: Description Staff Memo - Summary of the Ordinance Amendment Engineering Memo - Transportation and Sustainability Ordinance No. 2021-07 - Draft Ordinance Recommended by the Planning Commission Parking Regulation Summary from Chair Agnew & Commissioner MIranda Proposed Parking Ordinance applied to recent projects Comparison of Other Cities Parking Regulations Better Together Public Hearing Report Staff Presentation Staff Presentation 1 Staff Presentation 2 City Hall • Phone 952-927-8861 Fax 952-826-0389 • www.CityofEdina.com Date: July 19, 2022 To: City Council From: Cary Teague, Community Development Director Re: Zoning Ordinance Amendment – Off-Street Parking Regulations. As directed by the City Council at the April work session with the Planning Commission, attached is the proposed ordinance amendment regarding off-street parking regulations. This ordinance is the first step in the Planning Commissions work plan item to address parking regulations in the City of Edina. The City’s current regulations have not been revised since 1992. Many of the current standards have not been amended since 1970. Parking requirements often arise when new developments are proposed. Developers sometimes seek to have more or fewer parking spaces than guided by Edina’s Parking Regulations, and residents are sometimes concerned about proposed developments that are perceived to potentially include too much or too little parking. Goals and factors considered during the evaluation of the parking regulations include: trends nationally and around the Twin Cities metropolitan area regarding parking requirements; usage of decades-old parking lots within Edina; current and projected quantities and availability of mass transit; differing needs for different areas of Edina, such as locations where the City has provided mass parking facilities; creating incentives for reduced parking, including sustainability incentives, increasing greenspace, and enhancing mass transit and other forms of multi-modal transportation, such as bike/pedestrian connectivity; climate change and equity; reducing surface parking lots; and previous approvals or rejections of requested variances to Edina’s parking regulations. The Planning Commission recognizes the continued need to consider district parking structures, multi-modal options, and a robust mass transit system. This ordinance would serve as an interim first step to achieve greater goals in regard to parking. Benefits of reducing minimum parking requirements may include: Lowering cost for building projects could reduce rents for multi-family residential. Potential to provide more affordable housing. Reduction in car emissions (if more people use transit, walk or bike). Potential for more green space and landscaping and potentially public realm/public space. Less surface parking creates more land available for development which increases tax base, which helps keep residential taxes lower. The following has been considered in the analysis: Parking regulations for municipalities within the Twin Cities. (see attached comparison table) City of Edina • 4801 W. 50th St. • Edina, MN 55424 Parking regulations for similar and recommended municipalities within the United States. (see attached) The Planning Commission is asked to conduct a public hearing and consider the attached Draft Parking Ordinance Amendment. Highlights of the Ordinance Amendment include: Adding incentives for developers to reduce parking including shared parking, bike parking. sustainability and location near transit stops. Adding maximum limits on parking spaces. Having separate regulations within the City’s commercial nodes. Generally reducing the number of parking stalls required. Staff has put together a table (see attached) that compares recent projects in Edina, to the current ordinance and proposed ordinance. It shows the number of parking spaces that that the proposed ordinance would have required, compared to the current ordinance and the number of stalls that were built or will be built. Note that variances would not have been required in most instances, which demonstrates the ordinance is in line with what developers are building within their projects. The following provides some background on the draft ordinance and the changes recommended: Section 1. General Reduction in parking requirement. Uses may be allowed further reductions if located within a transit service area. Some of the more significant changes are as follows: Apartments – Reduced from 2 spaces per unit to 1.25 minimum and 1.75 maximum spaces per unit. The requirement for 1.25 spaces is consistent with most recent requests for new apartments within Edina. Medical or dental offices, clinics and animal hospitals – Reduced from one space per 200 square feet to one space per 300 square feet. Hospitals – Reduced from one space per bed to one space for each two patent beds. Restaurants – Changed from one-third the seating capacity to one space for each 100 square feet of floor area. Offices, medical and dental – Requirements are amended from a formula calculation (generally one space per 200 square feet) to one space per 300 square feet, with a maximum of one space per 200 square feet. Mixed Development District – Uses are amended to be consistent with specific use requirements. Residential reduced from 1.75 spaces per unit to 1.0 spaces per unit with a maximum of 1.75 spaces per unit. Additional incentives are provided for shared use. City of Edina • 4801 W. 50th St. • Edina, MN 55424 Section 2 – Planned Commercial Districts. This establishes separate regulations for the City’s Commercial Nodes (44th and France, 70th and Cahill, Valley View and Wooddale, 50th and France, Southdale and Grandview). Section 3 – Parking Space Reductions. Reduction/incentive provisions are added for ridesharing, environmental sustainability, and bike parking. A ten (10%) reduction is allowed if a use is located within one quarter of a mile from a qualified transit stop; to qualify, the transit stop must be served by regular transit service on all days of the week and adequate pedestrian access must be available between the transit stop and the parcel. Section 4. Additional Regulations. Additional regulations cover shared parking, proof-of-parking, and prevent two abutting off-street parking facilities next to each other. The following highlights the reductions made to the draft ordinance and the current draft: Use Current Ordinance 1-27 Draft Regulation Proposed Ordinance Apartments 2.0 spaces per unit 1.25 spaces per unit minimum 1.25 spaces per unit minimum with a 1.75 space per unit maximum Nursing Home One space per 4 patients or residents One space per 4 patients or residents One space per 5 patients or residents Community Center One space per 200 s.f. One space per 200 s.f. One space per 250 s.f. Medical, dental, clinic & animal hospital One space per 200 s.f. One space per 250 s.f. One space per 300 s.f. Restaurant 1 space per 3 seats One space per 100 s.f. plus one space per 150 s.f of outdoor space One space per 100 s.f. no requirement for outside seating Office Formula based on size (generally one space per 200 s.f. One space per 250 s.f. One space per 300 s.f. with a max of one space per 200 s.f. Residential use in a Mixed Development District 1.75 spaces per unit 1.25 spaces per unit minimum 1.0 spaces per unit with a maximum of 1.5 spaces per unit Residential use in a Planned Commercial District 1-1.5 spaces per unit depending on unit size 1.0 spaces per unit minimum 1.0 spaces per unit with a maximum of 1.5 spaces per unit Office use in a Planned Commercial District One space per 200 s.f. One space per 300 s.f. One space per 350 s.f. with a maximum of one space per 200 s.f. Shopping Center within a Planned Commercial District One space per 200 s.f. One space per 300 s.f. One space per 350 s.f. City of Edina • 4801 W. 50th St. • Edina, MN 55424 July 6, 2022 Cary Teague, Community Development Director Andrew Scipioni, Transportation Planner Grace Hancock, Sustainability Manager Ordinance 2021-07, Amending Off-Street Parking Regulations Information/Background In 2020, the City Council requested that the Planning Commission evaluate the appropriateness of the City’s Off-Street Parking Regulations. Many of the current regulations have not been significantly modified since 1992. In May 2021, the Transportation Commission (ETC) issued an advisory communication recommending approval of the draft ordinance amendments with some suggested revisions (see attached). This memo will review the draft ordinance amendments through the lens of the City’s strategic transportation and sustainability goals and suggest revisions to the ordinance amendment that support those goals. Section 1. Parking Minimums Staff supports the recommended revisions in this section as they are consistent with current industry standards. The added language under Section W. Mixed Development Districts supports the Comprehensive Plan goals to “develop and management parking provision to encourage joint and shared use of facilities” and to “reduce the overall dependence on and use of single-occupancy vehicles by promoting land use patterns that allow for shorter vehicular trips and the use of alternative travel options.” While these revisions to parking minimums are a step in the right direction, the Climate Action Plan recommends completely eliminating parking minimums to reduce surface parking. This practice has been adopted recently in the Cities of Minneapolis and St. Paul. As an intermediate step towards this objective, staff recommends future consideration of parking minimum elimination in areas that are; reliably served by transit (as the City of St. Paul previously implemented adjacent to the Green Line light rail stations); or, can be safely accessed/traversed by both pedestrian and bicycle facilities. This type of deliberate elimination would allow for sustainable growth, reduce reliance on single-occupancy vehicles, increase transit ridership and could provide opportunities for improved or expanded transit service. STAFF REPORT Page 2 Section 3. Parking Space Reductions Staff supports the premise of allowing for parking reductions in exchange for investment in multi-modal infrastructure (transit, car-share parking or bicycle parking). However, some additional revisions are recommended to satisfy this premise; 1. Transit – Staff recommends including additional requirements recommended by the ETC’s advisory communication. To qualify for the reduction, not only should “the transit stop…be served by regular transit service on all days of the week and adequate pedestrian access…be available between the transit stop and the parcel,” but information about transit routes and schedules should be posted in public spaces within the building to encourage the use of transit. 2. Car-share Parking – Staff recommends that reserved parking spaces for car-share vehicles be provided in convenient, accessible locations within 50 feet of a public entrance to a principal building. 3. Environmental Sustainability – This section is inconsistent with the other sections as it does not provide for an alternative mode of transportation. Sacrificing off-street parking for low-impact development strategies without providing alternative transportation would likely result in highly congested surface lots and overflow parking onto adjacent surface lots and/or public streets. Staff would instead recommend that as a condition of subsections 1, 2 and 4, “the area which would have been occupied by the eliminated parking spaces must be devoted to pervious surfaces, storm water facilities, tree retention or native landscaping as directed by the city planner. The area shall be calculated as 162 square feet (reflecting a 9’ by 18’ full-sized stall) per reduced parking space.” 4. Long-Term Bicycle parking – Staff recommends that bike parking spaces be located in convenient, well-lit locations within 50 feet of a public entrance to a principal building. Rack style and spacing for surface and underground bike storage should follow the recommendations of the Association of Pedestrian and Bicycle Professionals. Section 4 – Additional Parking Regulations Staff supports the encouragement of shared parking, which supports goals within the Comprehensive Plan and Climate Action Plan. Attachments May 20, 2021 Transportation Commission Advisory Communication First Reading – City Council on July 21, 2021 Existing text – XXXX Stricken text – XXXX Added text – XXXX DRAFT - ORDINANCE NO. 2021-07 - DRAFT AN ORDINANCE AMENDMENT REGARDING OFF STREET PARKING REGULATIONS THE CITY COUNCIL OF EDINA ORDAINS: Section 1. Sec. 36-1311 – Minimum number required. Shall be amended as follows: (a) Single dwelling units, double dwelling units and residential townhouses. One fully enclosed space per dwelling unit. (b) Apartment buildings in the PRD district. (1) 1.25 At least 1.25 spaces per dwelling unit but no more than 1.75 spaces per dwelling unit. At least one fully enclosed space per unit required. (c) Senior citizen dwelling unit buildings in the PSR-4 and PSR-5 subdistricts. (1) 0.5 exposed spaces and 0.25 enclosed spaces per senior citizen dwelling unit. (2) In addition to subsection (c)(1) of this section, the following spaces are required: a. One completely enclosed and one exposed space for each non senior citizen dwelling unit located in a building in the Planned Senior Residence District. b. One completely enclosed space per vehicle owned by the building's management and stored on the property; and c. One exposed space for each employee who is not a resident of the building. At least 0.75 spaces per bedroom, plus one space per employee on a maximum shift, plus one space per vehicle owned by the building's management (d) Nursing, convalescent and rest homes. At least one space for every four five patients or residents based on the maximum capacity of the building, plus one space per employee on the major shift, plus one space per vehicle owned by the building's management. (e) Day care, nurseries and preschools (principal use). At least one space per teacher or employee, plus one space per 20 individuals (or major fraction) receiving care. (f) Public or private senior high schools and seminaries. At least one space per classroom plus one space per ten students, or spaces equal in number to one-third the maximum seating capacity of the largest place of assembly, whichever is greater. (g) Public or private elementary or junior high schools. At least two spaces per classroom, or spaces equal in number to one-third the maximum seating capacity of the largest place of assembly, whichever is greater. (h) Community centers. At least as many spaces equal in number to one-third the maximum seating capacity of the largest place of assembly, or one space for each 200 250 square feet of gross floor area, whichever is greater. Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 2 (i) Churches and other religious institutions. At least as many spaces equal in number to one-third the maximum seating capacity of the largest place of assembly, plus spaces for other church facilities which are used concurrently with the largest place of assembly, the number of which shall be determined by the council in connection with the granting of a conditional use permit. (j) Theaters (except within shopping centers), stadiums, auditoriums, arenas, lodge halls, mortuaries, and clubhouses. At least as many spaces equal in number to one-third the maximum seating capacity, plus one space for each employee on the major shift. (k) Governmental administration, public service, post office. At least the greater of one space: (1) Per employee on the major shift, plus one space per government-owned vehicle, plus ten visitor spaces; or (2) For each 200 250 square feet of gross floor area. (l) Libraries, art galleries. Ten spaces, plus one space for each 300 square feet of gross floor area. (m) Medical or dental offices, clinics and animal hospitals. At least one space for each 200 300 square feet of gross floor area, plus one space per physician, dentist or veterinarian. (n) Hospitals. At least one space per bed for each two patient beds, plus one space per employee or volunteer on the major shift. (o) Athletic, health and weight reduction facilities. (1) Six At least four spaces per court for handball, racquetball, and tennis courts. (2) At least one space per 200 400 square feet of gross floor area for all other uses. (p) Restaurants (except within shopping centers). Spaces equal in number to one-third the maximum seating capacity, At least one space for each 100 square feet of indoor floor area, plus one space for each employee on the major shift and one space for each loading dock. (q) Carwashes. At least one space per employee on the major shift, plus five spaces for each wash lane, plus stacking spaces in accordance with section 36-1264. (r) Accessory carwashes. At least two parking spaces, plus stacking spaces in accordance with section 36-1264. (s) Gas stations. At least one space per employee on the major shift, plus one space for each 100 300 square feet of accessory retail uses in excess of 500 square feet exclusive of restrooms, storage areas and mechanical equipment. (t) Automobile service centers. At least three parking spaces per service bay, plus one space per employee on the major shift, plus one space for each 100 300 square feet of Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 3 accessory retail uses in excess of 500 square feet exclusive of restrooms, storage areas and mechanical equipment. (u) Bowling alleys. At least five spaces per lane. (v) Offices, medical and dental laboratories, business or professional offices, financial institutions, employment agencies and travel bureaus. Gross Floor Area (GFA) (in square feet) Number of Spaces 0—20,000 GFA/200 20,001—220,000 GFA/[(0.00025*GFA)+195] Over 220,000 GFA/250 At least one space per 300 square feet plus one space for a loading zone dock minimum with a maximum of one space per 200 square feet. (w) Mixed Development District. (1) Residential. One enclosed space, plus 0.75 exposed space, per dwelling unit. At least one space per dwelling unit but no more than 1.5 spaces per dwelling unit. (2) Nonresidential. Excluding publicly owned facilities and uses accessory to residential uses: Shall be regulated per Section 36-1311 above. Gross Floor Area (GFA) (in square feet) Number of Spaces 0—20,000 GFA/200 20,001—220,000 GFA/[(0.0005*GFA)+190] Over 220,000 GFA/300 (3) Where a single building contains there is combined within a single building an office use and a commercial restaurant use, up to 30% of the required office use parking supplied to meet the requirement for the office use may also be used to meet satisfy the restaurant parking requirement. for the commercial restaurant. Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 4 (4) Where there is combined within a single building contains an office use and a residential use, up to 40% of the required office use parking supplied to meet the requirement for the office use may also be used to meet the satisfy the residential use parking requirements for the residential use, provided that the number of residential parking spaces required for residential parking shall never be less than one (1) parking space per dwelling unit. (5) Where there is combined within a single building contains an office use, a residential use, and a commercial restaurant, up to 40% of the required office use parking supplied to meet the requirement for the office use may also be used to meet the satisfy the residential use parking requirements for the residential use, provided that the number of spaces required for residential parking shall never be less than one (1) parking space per dwelling unit, and up to 30% of the parking supplied to meet the requirement for the office use may also be used to meet the requirement for the commercial restaurant. (x) Multitenant industrial buildings. At least one space for each 400 500 square feet of gross floor area, or the sum of the component gross floor areas as follows, whichever is greater: (1) One space for each 200 300 square feet of office space. (2) One space for each 2,000 square feet of warehouse space. (3) One space for each 300 square feet of manufacturing, processing, packaging, treatment and assembly space. (4) One space for each 500 square feet of space containing machines and equipment for conducting scientific research, testing or experimentation. (5) One space for each 200 400 square feet of facilities for athletic, health and weight reduction purposes; six spaces per court for handball, racquetball or tennis. (y) Automobile and boat sales, new or used. At least one space per 250 square feet of gross floor area, including showrooms, sales space and offices, but excluding service areas, plus three spaces for each service bay. Required parking spaces shall not be used for the storage or display of vehicles, boats, or other products. (z) Furniture and major appliance sales. (1) Over 2,500 square feet of gross floor area. At least one space per 400 square feet of gross floor area. (2) Under 2,500 square feet of gross floor area. At least one space per 200 square feet of gross floor area. (aa) Hotels and motels. At least one space per guest unit, plus one space for each employee on the major shift. (bb) Taproom and cocktail room. At least one space per 40 square feet of gross floor area. Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 5 (cc) Brewery, winery and distillery without on-site sales. At least one space per 1,000 square feet of gross floor area. (dd) Brewpub, brewery, winery and distillery with on-site sales. At least one space per 1,000 gross square feet of production floor area, and spaces equal in number to one-third the maximum seating capacity, plus one space for each employee on the major shift for the restaurant. (ee) Uses not Specified. Where ambiguity exists in the application of off-street parking requirements, or where the parking requirements for a use are not specifically defined herein, the parking requirements for such use shall be determined by the city planner or the city planner’s designee and such determination shall be based upon the requirements for the most comparable use specified in this chapter. Section 2 Sec. 36-1312. - Planned Commercial District. Shall be amended as follows: For uses allowed in the Planned Commercial District, except uses for which a parking quantity is otherwise specified, the following applies minimum spaces are as follows: (1) Planned Commercial District – 1 (PCD-1) (Areas include: 70th and Cahill, ValleyView/Wooddale, 44th and France) Retail. Eight spaces for the first 1,000 square feet, plus six spaces for each 1,000 square feet of gross floor area in excess of the original 1,000 square feet, but not exceeding 15,000 square feet, plus five spaces for each 1,000 square feet in excess of 15,000 square feet. At least one (1) space per 250 square feet. Multiresidential uses. At least one fully enclosed parking space for each dwelling unit minimum, with a maximum of but no more than 1.5 spaces per dwelling unit, except that dwelling units with a floor area in excess of 1,500 square feet must provide 1.50 fully enclosed parking spaces per dwelling unit. Such parking spaces must be designed for the exclusive use of residents of the dwelling units and their guests. The council may require the provision of exposed parking spaces in addition to the required enclosed spaces as a condition to the issuance of a conditional use permit. Office. At least one space per 350 square feet plus one space for a loading zone dock minimum with a maximum of one space per 200 square feet. (2) Planned Commercial District – 2 (PCD-2) (50th and France, area defined in the 50th and France small area plan) Parking for uses in the 50th and France commercial node may rely on the City Parking Ramps with a floor area ratio up to 1.0 as defined in Section 36-10. Uses exceeding 1.0 must provide additional off-street parking spaces for the square footage above 1.0. Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 6 Multiresidential uses. At least one fully enclosed parking space for each dwelling unit minimum, with a maximum of but no more than 1.5 spaces per dwelling unit, except that dwelling units with a floor area in excess of 1,500 square feet must provide 1.50 fully enclosed parking spaces per dwelling unit. Such parking spaces must be designed for the exclusive use of residents of the dwelling units and their guests. The council may require the provision of exposed parking spaces in addition to the required enclosed spaces as a condition to the issuance of a conditional use permit. (3) Planned Commercial District – 2 (PCD-2) (Grandview, area defined in the Grandview Development Framework) Retail. Eight spaces for the first 1,000 square feet, plus six spaces for each 1,000 square feet of gross floor area in excess of the original 1,000 square feet, but not exceeding 15,000 square feet, plus five spaces for each 1,000 square feet in excess of 15,000 square feet. At least one (1) space per 250 square feet. Multiresidential uses. At least one fully enclosed parking space for each dwelling unit minimum, with a maximum of but no more than 1.5 spaces per dwelling unit, except that dwelling units with a floor area in excess of 1,500 square feet must provide 1.50 fully enclosed parking spaces per dwelling unit. Such parking spaces must be designed for the exclusive use of residents of the dwelling units and their guests. The council may require the provision of exposed parking spaces in addition to the required enclosed spaces as a condition to the issuance of a conditional use permit. Office. At least one space per 350 square feet plus one space for a loading zone dock, minimum with a maximum of but no more than one space per 200 square feet. (4) Planned Commercial District – 3 (PCD-3) (Property zoned PCD-3 within the Greater Southdale area as defined in the Southdale District Plan) Shopping centers (6+ businesses and at least 25,000 square feet.). At least one space per 200 350 square feet of gross floor area (including theaters and restaurants), plus one additional space for each ten seats in a restaurant, theater or other place of assembly. Atrium areas and mall areas, not used for retail sales purposes, shall be excluded from gross floor area calculations. Multiresidential uses. At least one fully enclosed parking space for each dwelling unit minimum, with a maximum but no more than 1.5 spaces per dwelling unit, except that dwelling units with a floor area in excess of 1,500 square feet must provide 1.50 fully enclosed parking spaces per dwelling unit. Such parking spaces must be designed for the exclusive use of residents of the dwelling units and their guests. If a conditional use permit is required, the council may require the provision of exposed parking spaces in addition to the required enclosed spaces as a condition to the issuance of a conditional use permit. Retail. Eight spaces for the first 1,000 square feet, plus six spaces for each 1,000 square feet of gross floor area in excess of the original 1,000 square feet, but not exceeding Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 7 15,000 square feet, plus five spaces for each 1,000 square feet in excess of 15,000 square feet. At least one (1) space per 250 square feet. Section 3 Sec. 36-1324. Parking Space Reductions Section 36-1324 is amended to add the following: Reductions. The following off-street parking reductions may be utilized jointly or separately except as indicated otherwise: (1) Transit. The required aggregate number of spaces for a building may be reduced by ten percent 10% if the building is located within one quarter of a mile from a qualified transit stop; to qualify, the transit stop must be served by regular transit service on all days of the week and adequate pedestrian access must be available between the transit stop and the parcel. (2) Car-share Parking. A reduction of up to one space per reserved parking space for car share vehicles or 5% of the overall number of required parking spaces, whichever is greater, may be granted for any development that provides reserved parking for use by car-share vehicles. Reserved parking spaces Parking for car-share vehicles may be provided in any required or non-required off-street parking space. (3) Environmental Sustainability. With the consent of the city planner or the city planner’s designee upon review of potential adverse impacts, a maximum reduction of up to ten percent 10% reduction in the number of required parking spaces in parking requirements may be approved in the following circumstances: for parking areas composed of pervious pavement or where the reduced parking area is used for a low impact development storm water facility; and a A reduction up to 20% of the number of required parking spaces requirements may be approved by the city planner or the city planner’s designee for clustered site design where if the reduced parking area is used for tree retention or native landscaping. The area which would have been occupied by the eliminated parking spaces must be devoted to pervious surfaces, storm water facilities, tree retention, and native landscaping as directed by the city planner. (4) A 10% reduction in parking may be approved by the city planner or the city planner’s designee provided that one of the following conditions are met is provided for the following: (a) If a residential use: 1 covered, long-term bicycle parking space per 3 dwelling units. (b) If a retail or service use: 1 covered, long-term bicycle parking space per 5,000 square feet of retail or service uses. (c) 1 short-term bike space per 5,000 s.f. of retail/services uses. In order to qualify for this reduction, the long-term bicycle parking must: (a) Be protected from weather and from access by unauthorized persons; Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 8 (b) Consist of bike racks or lockers anchored so that they cannot be easily removed; and (c) Allow both the bicycle frame and the wheels to be locked with the bicycle in an upright position using a standard U-lock; Section 4 Sec. 36-1325. Additional Parking Regulations. Section 36-1325 is amended to add the following: (1) Shared Parking. The following criteria are guidelines for negotiating private agreements for shared parking. Applicants wishing to deviate from parking regulations must apply to the City for a variance from parking requirements. Situations not covered by 36-1311 (w) and (x), may apply to shared off-street parking facilities with other uses, even if the uses are in different structures are allowed to collectively provide parking in any district for more than one structure or use, subject to the following criteria conditions: (a) The applicant(s) must provide evidence that there is no substantial conflict in the principal operating hours of the buildings or uses for which the proposed shared joint use of off-street parking facilities. is proposed. For purposes of this subsection, no substantial conflict shall mean either: (a) up to 75 % of the required parking for daytime use may be provided in the parking facilities of a nighttime or weekend use; or (b) up to 75% of the required parking for a nighttime or weekend use may be provided in the parking facilities of a daytime use. The application must include a parking plan shall that address the hours, size, and mode of operation of the respective uses. Within the Planned Commercial District, an applicant shall document proposed joint-use shared parking proposals through the use of via the Urban Land Institute Shared Parking Model (ULI Shared Parking, Second Edition). (b) The minimum spaces required under a shared parking agreement shall be based on the number of spaces required for the use that requires the most parking. (c) A form agreement for shared parking facilities shall be developed by the city attorney. shall be protected by an irrevocable legal agreement The agreement must running with the land. After the city council approves the agreement then it must be and recorded with the county in a form approved by the city attorney. A certified copy of the recorded document shall be provided to the city planner within 60 days after council approval of the agreement by the city council. A certified copy of the recorded document shall be provided to the city planner within 60 days of recording. (d) To qualify, the application must show that all parking addressed by the application is located must be supplied within 300 feet of the benefitted Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 9 structure’s main entrance. Additionally, adequate pedestrian access must be available between the benefitted principal structure and all parking spaces. (2) Proof of parking measures. An applicant may Applicants who do not utilize other parking reduction sections of this chapter may still receive a reduction of required parking spaces in one of two ways. The first is to demonstrate a lack of need for some spaces via a parking study. The second is to defer space that is set aside for the required amount of parking spaces which may be converted to parking later. be eligible for a reduction in the required number of off-street parking spaces where the applicant can demonstrate there is lesser need for the required number of off-street parking spaces, and/or there is a space set aside for code complying off-site parking spaces to be constructed if a need is later indicated by the city issuing authority, provided: (a) Where the applicant is seeking a reduction in the total number of required constructed parking spaces, the lesser number of constructed spaces may be allowed, provided: (a) Parking Study. The applicant must conduct a parking study as follows: (i) The city would require a parking study must be conducted in accordance with city-approved methodologies. (ii) The study must be prepared by an independent traffic engineering professional under the supervision of the city and paid for by the applicant. (iii) In order to reduce the number of required spaces, the study must demonstrate that there is not a present need for the portion of parking for which the applicant is requesting proof of parking flexibility. (ii) The city planner or the city planner’s designee shall review the parking study. Upon finding that the study sufficiently demonstrates a lack of demand the City shall approve of the reduced number of parking spaces. Where a site plan is approved with proof of parking measures, a properly drawn legal instrument, memorializing the parking measures drafted and executed by the parties concerned, must be filed with the records for that property in the Registrar of Titles’ or Recorder’s office of the county with proof thereof presented to the issuing authority. (b) Suitability of Deferred Spaces. (i) The applicant must not assign deferred parking spaces to areas required for landscaping, required buffer zones, setbacks, fire lanes, drive aisles or areas that would otherwise be unsuitable for parking spaces because of the physical characteristics of the land or other requirements of this code. Existing text – XXXX Stricken text – XXXX Added text – XXXX City Attorney Revisions - XXX 10 (ii) Conversion of deferred spaces by applicant. The applicant may at any time request that the issuing authority city approve a revised site plan to allow conversion of deferred spaces to operable parking spaces. (iii) The city planner or the city planner’s designee may at any time determine that the deferred space be converted into operable parking spaces. (3) The placement of two (2) abutting off-street parking facilities with continuous street frontage shall not be permitted. Section 5. This ordinance is effective immediately upon its passage. First Reading: July 21, 2021 Second Reading: Published: Attest Sharon Allison, City Clerk James B. Hovland, Mayor Parking in Edina By Lou Miranda & Kate Agnew – 19 July 2022 Planning Commission Presentation To Edina City Council Goals Sustainability • Climate Action Plan: Reduce VMT, increase transit: A city gets what it builds for Equity & Affordability of housing • Parking mandates drive up cost of housing Local economy • Walkable neighborhood nodes with retail & dining build community, tax base Children • Reduce congestion, ensure children & families are safe in neighborhood nodes Strategy Tell a Story •Edina started as a streetcar suburb; what kind of future do we want for our children? (Pages 3 through 8 of Nelson\Nygaard report) Big Picture •Comp Plan: planning, housing, transportation, & equity require an integrated plan (page 23 of Nelson\Nygaard report) Multiple Steps •Phase in ordinance changes (pages 9 through 29 of Nelson\Nygaard report) Communicate Benefits • Parking Benefit Districts vary by neighborhood node: “Your neighborhood isn’t Southdale” (page 20 of Nelson\Nygaard report) Results Collaboration •Planning & Transportation Commissions working together Plans •Off-street parking ordinances •On-street parking management plan (page 31 of Nelson\Nygaard report) •City-wide transportation plan integrating walking, biking, transit, & cars Edina as a Leader •A first-class community that is attractive to the amazing new families that move here Phases with Scale-of-Change Examples Short Term A.High: Remove all parking minimums B.Medium: Reduce all parking minimums C.Low: Reduce some minimums Medium Term A.High: Parking caps/ maximums (page 26 of Nelson\Nygaard report) B.Medium: Remove parking minimums; add parking benefit districts C.Low: Reduce all parking minimums Long Term A.High: transformative change (UN IPCC report) B.Medium: City-wide transportation plan; parking maximums C.Low: Parking benefit districts Phases with Scale-of-Change Examples Short Term A.High: Remove all parking minimums B.Medium: Reduce all parking minimums C.Low: Reduce some minimums Medium Term A.High: Parking caps/ maximums (page 26 of Nelson\Nygaard report) B.Medium: Remove parking minimums; add parking benefit districts C.Low: Reduce all parking minimums Long Term A.High: transformative change (UN IPCC report) B.Medium: City-wide transportation plan; parking maximums C.Low: Parking benefit districts This ordinance Project Examples Current Ordinance Proposed Ordinance 4500 France Restaurant Proposed (Variance was denied by the City Council) Examples are based on the square footage of the space available. 100 seat restaurant (3,700 s.f.) = requires 43 spaces required 3,700 s.f. restaurant = 42 spaces required (using the 10% reduction - transit stop) This project did not meet the current ordinance and would not meet the proposed ordinance 70th and France Retail (50,000 s.f) & Office (140,000 s.f.) = 1,006 spaces Residential = 379 enclosed spaces 1,385 spaces total required Retail (50,000 s.f) & Office (140,000 s.f.) = 702 spaces Residential = 341 enclosed spaces 1,043 spaces minimum required; and 1,411 maximum spaces allowed) (1,170 stalls are proposed – meets the proposed ordinance) 6950 France (New Furniture Store) 10,000 s.f. of retail = 62 spaces required 10,000 s.f. of retail = 40 spaces required (51 spaces were installed – meets the proposed ordinance, variance was required under the existing ordinance) Amundson Flats (70th and Cahill/Amundson) 62-unit apartment 2 spaces per unit (1.25 enclosed) 124 total required (77 enclosed) 62-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 77 total minimum spaces required; and 109 maximum spaces allowed (62 enclosed) (94 stalls total, 62 enclosed approved – meets the proposed ordinance) Aeon Housing Project (76th Street) 70-unit apartment 2 spaces per unit (1.25 enclosed) 140 total required (70 enclosed) 70-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 70 total minimum spaces required; and 123 maximum spaces allowed (70 enclosed) (87 stalls total, 64 enclosed approved – meets the proposed ordinance) Hazelton Apartments 185-unit apartment 2 spaces per unit (1.25 enclosed) 370 total required (185 enclosed) 185-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 231 total spaces required; 324 spaces maximum allowed (185 enclosed) (277 stalls enclosed approved – meets the proposed ordinance) 7200-7250 France Development (approved by never built) 309-unit apts.-2 space per unit (1.25 enclosed = 618 spaces 30,000 s.f. retail/office = 146 spaces Total Required = 764 spaces 309-unit apt.-1.25 spaces per unit (1 enclosed) & 1.75 maximum = 386 total required & 540 max. (309 enclosed) 30,000 s.f. retail/office = 120 spaces Total Required = 506 spaces minimum required and 660 maximum allowed (590 stalls approved, with 540 underground – meets the proposed ordinance) Avenue on France (project denied by City Council) Mixed Use District Nonresidential = 1/300 s.f. (708,348 s.f.) 2,361 spaces required Residential = 1 enclosed space/unit (239) + .75 spaces exposed per unit (179) 418 spaces required 2,779 total spaces required Mixed Use District Nonresidential = 1/300 s.f. minimum and 1/200 maximum (708,348 s.f.) (10% reduction – bus stop) 2,125 spaces required & 3,188 max. Residential = 1 enclosed space/unit minimum and 1.5 spaces maximum (239) 215 spaces minimum required and 358 maximum (Council could add spaces if necessary) 2,340 minimum total spaces required and 3,546 maximum allowed – 2,873 spaces proposed therefore would have met the proposed ordinance Land Uses Current Ordinance Proposed Ordinance Nursing Home One space per 4 patients or residents One space per 5 patients or residents Community Center One space per 200 s.f. One space per 250 s.f. Medical, dental, clinic & animal hospital One space per 200 s.f. One space per 300 s.f. Restaurant 1 space per 3 seats One space per 100 s.f. Office Formula based on size (generally one space per 200 s.f. One space per 300 s.f. with a max of one space per 200 s.f. Residential use in a Mixed Development District 1.75 spaces per unit 1.0 spaces per unit with a maximum of 1.5 spaces per unit Residential use in a Planned Commercial District 1-1.5 spaces per unit depending on unit size 1.0 spaces per unit with a maximum of 1.5 spaces per unit Office use in a Planned Commercial District One space per 200 s.f. One space per 350 s.f. with a maximum of one space per 200 s.f. Shopping Center within a Planned Commercial District One space per 200 s.f. One space per 350 s.f. City Office Medical Office Retail Shopping Center Restaurants Apartments Sr apartments Edina - Current Ordinance 1/200-1/250 sf 1/200 sf 1/167- 1/200 1/200+1/10 seats (formula)1/3 seats + employ 2/unit .75+employ Edina 1-27 draft 1/250 sf 1/250 sf 1/250 sf 1/300 sf 1/100 s.f. plus 1/150 s.f of outdoor space 1-1.25/unit .75+employ Edina 2-24 draft 1/300 sf (1/200 max)1/300 sf 1/250 sf 1/350 sf 1/100 sf + employee 1-1.25/unit with 1.75 max .75+employ ITE Parking Standard 1/380 s.f.1/375 sf 1/380 sf 1/244 sf (December) 1/343 (non Dec.)1/81 sf + employee 1/unit - high rise 1.32/unit - mid rise .61+employ Eden Prairie 1/200-333 max 1/200- 333 max 1/200- 1/333 1/200- 1/333 max 1/3-1/2max1/3-1/2 max 1/unit TBD Minnetonka 1/250 1/175- 20 min 1/250 1/250 1/2.5 seats 2/unit 1/unit Saint Louis Park 1/200-250 max 1/200-250 max 1/250- 1/150 max 1/250 1/60 sq ft 1/bed 1/unit Richfield 1/275- 350 max 1/200- 250 max 1/200-1/285 1/250 1/100 sq ft 2/unit/1.25TBD TBD Bloomington 1/285 1/285 1/180- 1/220 460+1/285 1/ 3 seats 1.8/1 bed-.75 1.5/unit Golden Valley 1/250 1/200 1/250 1/200 1/60-100 sq ft 1.5/unit .5/1/unit Apple Valley 1/150-200 1/150 1/150 1/200 1/2.5 seats 1.5/unit 1.5 TBD Crystal 4+1/200-500 4+1/200-500 4+1/250 4+1/500 4+1/100 sq ft 2/per unit 2/unit Plymouth 1/250 - 300 1/200 1/200 1/200-300 1/40+1/80 kit 2/per unit 1.5/unit New Hope 1/300 1/300 1/200 1/200 1/40+1/80 kit 2.25 unit 1/unit+employ Brooklyn Park 1/181/200 1/150+Dr.1/200 1/200-240 1/40+1/80 kit 2/unit+.5 outside .5/unit Roseville 1/275-1/325 1/250 1/325 1/325 1/3 seats 1/employ 1.25/unit 1.25 unit Burnsville 1/666 - 200 3/Dr. 1/empl 1/150 - 1/200 1/200 1/3 seats1/2em 1/table 1,5 - 2.5 unit .5/unit Mpls 2/1000-1/200 2/1000 2/1000-1/200 1/200 2/1000-1/75 qs ft 1/unit 1/unit Highland Park* Office sites in Commercial Districts sites <15,000 sf: 2.5/1,000 >15,000 sf: 0 for first 2,000 sf, then 2.5/1000 additional sf >15,000 sf: 0 for first 2,000 sf, then 2.5/1000 additional sf 4.11 spaces per 1000 sf Development site <15000: 2.5/1000sf >15000: none for first 2000 sf then 2.5 spaces per 1000 sf 20 spaces per 1,000 sq. ft. GFA for kitchen area, serving counter and waiting area, plus 0.5 spaces per seat See attached word doc Nursing Facility: .33 space per resident Durham, NC* 1/250 1/250 1/200 to 1/250 sf 1/100 sf 2/unit .6/unit Park Ridge, IL* Office Park: 5/1000 / Professional Office 4/1000 1.5/exam room 3/1000 1/60 sf pulbic seating (excludes outdoor seating) 1.5 to 2 per dwelling unit .25 per bed + 1 per 2 employees Glenview, IL*1/300 1/300 1/300 1/3 people per max capacity 2 per unit 1/3 units Nashville, Tenn.1/300 sf 1/200 sf 1/200 sf 1 space per 250 square feet to 200 s.f. 1/100 sf and 10 spaces for takeout 1 to 1.5 per bedroom .5 spaces per unit Birmingham, Ala 1/300 sf 1/150 sf 1/300 sf 1/300-550 sf 1/75 sf 1.5-2/UNIT .5 spaces per unit Dublin Ohio 1/250 sf 1/200 sf 1/200 sf 1/200 sf 1/50 sf 2/unit 1/unit Charlotte, NC 1/300 sf 1/200 sf 1/200 sf 1/250 sf 1/75 sf 1.5-2/unit .25/unit Survey Responses 30 January 2019 - 12 July 2021 Public Hearing Comments Better Together Edina Project: Public Hearing: Parking Ordinance Amendments VISITORS 76 CONTRIBUTORS 31 RESPONSES 31 4 Registered 1 Unverified 26 Anonymous 4 Registered 1 Unverified 26 Anonymous Respondent No:1 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 13:03:47 pm Last Seen:Mar 19, 2021 13:03:47 pm IP Address:n/a Q1.First and Last Name RuthAnn Metzger Q2.Address 5600 Dale Ave Q3.Comment Since we are in a pandemic right now, I think these changes are not needed. People are not using public transportation like before the pandemic & now crime is increasing to unacceptable rates. We should be focusing on making people feel safe instead of trying to reduce development costs when development is already out of control. People who are single seniors or who have kids in multiple activities are not going to give up their cars so making fewer parking places is just creating more problems. Who is looking at the big picture? Respondent No:2 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 13:06:42 pm Last Seen:Mar 19, 2021 13:06:42 pm IP Address:n/a Q1.First and Last Name Joshua Root Q2.Address 6721 Sioux Trl. Q3.Comment Edina was built in an era when car travel was an expected experience. Changes to the parking requirements without understanding the realities the city was built under will result in residents in the vast majority of the city losing access to the businesses and residents being built today. If we change the parking requirements then we need to actually capture the potential benefits of green space etc. to justify the determinant of the car dependent. Respondent No:3 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 13:15:50 pm Last Seen:Mar 19, 2021 13:15:50 pm IP Address:n/a Q1.First and Last Name Ann Swenson Q2.Address 6021 Concord ave Q3.Comment I have a friend who moved three years ago into the apartments next to Byerlys in the greater Southdale area. The complex has underground stalls but now charges for them. The two building complex has about 18 spots designated for its building outside.These are hardly ever available. Think Bank has a big “we will tow you “ sign along with the two retail lots that are connected to the apartment buildings. Byerlys also says their lot is only for customers. The front office of the apartment tells its renters if needing outdoor parking to park in the Macy’s home store lot. Their guest parking is more than inadequate and if Macy’s redevelops will be even worse. Respondent No:4 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 14:18:41 pm Last Seen:Mar 19, 2021 14:18:41 pm IP Address:n/a Q1.First and Last Name Sherry Hottinger Q2.Address 405 Harrison Ave S, Edina, MN Q3.Comment Reduced parking is all well and good, all reasons cited are valid reasons to consider. The reality however is that mass transit is abysmal and walking/biking is only an option for a limited part of our annual season. Walking and biking in winter, especially while shopping, can be difficult or impossible for many people. Inadequate parking forces cars further into neighborhoods which is also not desirable. I'm not going to fight for parking near my destination. I will shop elsewhere because for me it's the only way to do what I need to do. I will happily take transit if it was available, nearby, clean and safe. The demographics around younger generations are promising for reduced cars and environmental thoughtfulness, but to reduce parking without having the alternatives in place is not a great idea. If the city truly addresses these issues by creating transit which is workable for people by all means, reduce parking. Respondent No:5 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 16:16:02 pm Last Seen:Mar 19, 2021 16:16:02 pm IP Address:n/a Q1.First and Last Name James L Wotipka Q2.Address 7710 Gleason Road Q3.Comment This sounds like another attempt to force people out of their cars. We do not need to win the title for most bicycle metro in the country. Our weather does not allow for practical use of bicycles all year long. As far as public transportation goes, getting to a bus requires long walks which are certainly not safe in our winters. If a residential development has x number of units than at a minimum it should have x number of parking spaces. Respondent No:6 Login:Anonymous Email:n/a Responded At:Mar 19, 2021 17:05:15 pm Last Seen:Mar 19, 2021 17:05:15 pm IP Address:n/a Q1.First and Last Name mary everett Q2.Address 5600 park place Q3.Comment The reality is: we live in MINNESOTA, we have a hard WINTER, we do NOT choose to take a bus or taxi, we pay HUGE property taxes and want to have 2-3 cars. We have children that have sports activities ALL over the cities and we are not putting our 5-18 year olds on a bus. What is with all these appointed liberals with these CRAZy ideas. We want cars, we want to drive. I feel as though the people with this agenda are appointed people, not people that are current residents or elected people? Maybe I am wrong and out of touch?. I don't know who comes up with these ideas but I believe that most residents, who have children as well as those of us that are older, have no interest in public transportation for our everyday transportation. Although it is great to walk to 50th and France I need my car and always will. I think Edina really needs to start listening to the people that live here, not appointed reps from outside our city. Respondent No:7 Login:Anonymous Email:n/a Responded At:Mar 20, 2021 04:44:59 am Last Seen:Mar 20, 2021 04:44:59 am IP Address:n/a Q1.First and Last Name Ann Makres Q2.Address 4912 69th Street Q3.Comment We should not reduce the number of parking spaces required for projects. There must be a minimum of 1 parking space per unit and a percentage ( the larger units) must be be required to allow two spaces Respondent No:8 Login:Anonymous Email:n/a Responded At:Mar 20, 2021 09:29:32 am Last Seen:Mar 20, 2021 09:29:32 am IP Address:n/a Q1.First and Last Name Aimee Makres Q2.Address 6450 York Ave S, #314 Edina, MN 65435 Q3.Comment I think there should be 2 spots for each livable unit built. In my condo there is only 1 parking spot per unit, yet two people live in a unit and each person has a car. There is not enough parking for everyone in my building and many use the adjacent office buildings parking lot. It takes 2 incomes to live in these condo buildings in Edina and we need 1 parking spot for each person. Respondent No:9 Login:Anonymous Email:n/a Responded At:Mar 20, 2021 11:30:16 am Last Seen:Mar 20, 2021 11:30:16 am IP Address:n/a Q1.First and Last Name Mary Landberg Q2.Address 5408 Creek View Lane Q3.Comment Changing to less parking required by builders will result in more parking on the street. I don't think this is a good idea. Look at the newest completed buildings. There is less space on the street no place for delivery trucks, trash removal trucks, etc. to park while they're completing their tasks. Bad, bad idea. Respondent No:10 Login:Anonymous Email:n/a Responded At:Mar 21, 2021 10:21:39 am Last Seen:Mar 21, 2021 10:21:39 am IP Address:n/a Q1.First and Last Name Liberta Ledder Q2.Address 6709 Cheyenne Trail Q3.Comment The city has moved to increase density over the past 15 years. We are now at a point of being overcrowded. Reducing parking would only exasperate the problems we have in the city with too much traffic, no availability parking, and high if not out of control density. Please do NOT change our parking ordinances. Please listen to the people of this community and not the developers. We pay your salary and are not happy with the growth we have seen. PLEASE LISTEN!!!! Respondent No:11 Login:Anonymous Email:n/a Responded At:Mar 21, 2021 11:33:15 am Last Seen:Mar 21, 2021 11:33:15 am IP Address:n/a Q1.First and Last Name Heather Tietz Q2.Address 6404 Glacier Place Q3.Comment Would expect the City to NOT allow changes that would drive increased street parking in residential neighborhoods. A huge part of the quality of life of a neighborhood is whether kids/families can safely bike and participate in other outdoor activities. High level of on-street parking makes those activities less safe. Parking requirements in higher density or commercial areas impact what a buyer (housing or commercial) is willing to pay which ultimately impacts long term tax revenues from the property. Hope the City factors that into the analysis; otherwise, may have short term gain and long term pain. Respondent No:12 Login:Anonymous Email:n/a Responded At:Mar 23, 2021 14:08:17 pm Last Seen:Mar 23, 2021 14:08:17 pm IP Address:n/a Q1.First and Last Name Lucia Copland Q2.Address 4805 Hibiscus Ave, Edina MN 55435 Q3.Comment I am not in favor or reducing minimum parking requirements, for the following reasons: Winter weather makes commuting by any other than motorized transportation (a) extremely difficult and (b) unlikely to occur. Winter weather is a likelihood for this area at least 5 months of the year, if not 6. Reduced parking hurts the disabled and the elderly disproportionately. Many seniors travel only by car for health reasons while not qualifying for handicapped parking spaces (for example, because of lowered immunity, back aches, high blood pressure). Edina should be a handicapped and senior citizen friendly community. COVID-19 has shown us the negative consequences of increasing the numbers of people who use public transportation. Pandemics are not going to end after this one. Reduced parking benefits developers FAR more than the community. Respondent No:13 Login:Anonymous Email:n/a Responded At:Mar 24, 2021 07:03:06 am Last Seen:Mar 24, 2021 07:03:06 am IP Address:n/a Q1.First and Last Name Kirk Aadalen Q2.Address 4800 Hilltop Lane Q3.Comment I am against reducing the number of parking spots required for new construction projects. There will be people that own cars moving into these new condos and apartments. Those cars need to go somewhere. Please do not lower the required number of spots for new commercial/residential projects in Edina. Respondent No:14 Login:Anonymous Email:n/a Responded At:Mar 25, 2021 10:56:07 am Last Seen:Mar 25, 2021 10:56:07 am IP Address:n/a Q1.First and Last Name Sandy Simmons Q2.Address 5038 Bruce Place Q3.Comment Reducing the number of minimum parking spots going forward sounds very 'green' but in fact completely ignores reality. We live in a winter climate with snow, rain, ice. People are not going to bike in the winter. Parents aren't going to carpool on bikes. Couples don't go out for dinner on bikes. Handicaps and age make biking difficult. Cars are here to stay and with increasing population and density, decreasing space for cars makes no sense at all. Our community is 'locked in' to its existing space. With the city continually approving increased density it needs to recognize decreasing parking will effect everyone's quality of life in Edina. Respondent No:15 Login:Anonymous Email:n/a Responded At:Mar 25, 2021 13:42:48 pm Last Seen:Mar 25, 2021 13:42:48 pm IP Address:n/a Q1.First and Last Name Dorothy Lodahl Q2.Address 5201 Richwood Drive Q3.Comment The premise to encourage walking, mass transit is fine - but mobility and age issues can prohibit using these amenities. If there are not enough parking spaces available - where will people park? In the street and during the winter plowing - I lived in Minneapolis for many many years - I appreciate the clear roads. Respondent No:16 Login:Anonymous Email:n/a Responded At:Mar 25, 2021 14:06:01 pm Last Seen:Mar 25, 2021 14:06:01 pm IP Address:n/a Q1.First and Last Name Kevin Newman Q2.Address 7408 Shannon Drive Q3.Comment I am against reducing the concept or proposal to reduce the minimum parking requirements. I believe the number of parking spots should at a minimum of two parking spot per unit. The city posting lists the “benefits” of reducing the minimum parking requirements, but the downside includes • Less desirable living units. o In today’s world, most families, especially those looking for affordable housing, have two working individuals. In most cases, they need two vehicles to get to work. • Crowded street parking with the overflow of tenant vehicles. • An increased risk of auto vandalism or theft. o The TWC is seeing a record number of car and catalytic converter theft. Local news recommends parking your car in a garage of secure lot. Specific to parking requirements, developers should build units based on today’s consumer wants and needs, not projected trends that rarely come true. If the trends come true and everyone takes mass transit in the future, parking lots can be redeveloped into green space. Respondent No:17 Login:Lynn Hechanova Email:Lhechanova@comcast.net Responded At:Mar 25, 2021 16:12:06 pm Last Seen:Mar 25, 2021 22:58:26 pm IP Address:66.182.125.93 Q1.First and Last Name Lynn Hechanova Q2.Address 5601 Dewey Hill Road #302 Q3.Comment Setting a maximum number of parking spots for residential units at 1.5 is overreacting. Many senior couples who would like to downsize their single family home, or who have a second home, still both drive. They may both still be working. Limiting their option to have 2 parking spots available discourages them from giving up their single family home making less room for younger families to move into Edina. We would not have considered moving from our single family home in Edina to a condominium that didn’t have 2 spaces available and we are in a designated senior condo in Edina. Respondent No:18 Login:Anonymous Email:n/a Responded At:Mar 26, 2021 18:40:14 pm Last Seen:Mar 26, 2021 18:40:14 pm IP Address:n/a Q1.First and Last Name Bill Noonan Q2.Address 6204 Chowen Ave S Q3.Comment I’m not in favor of reducing the number of parking stalls for buildings. Look at density housing in Minneapolis and you’ll notice that people park in the streets, a real mess in the winter. Mpls has had bike lanes for many years and they’re hardly used between October and April. Sure, a few diehards use bikes all year. Edina already created a two messes. One mess is the building on France where Stripes and others share a dinky parking lot, and a parking ramp with a very steep access. Another mess is the new apartment or condo complex that faces the post office on 49th. I don’t know why anyone would want to rent a condo/apartment that looks at a parking ramp facing north that may have one week of sunshine in a year. I think it is a mistake to allow a structure like this so we get more tax revenue. The idea that someone from out of state would come here to tell us about national trends in parking is a waste of time and money. Does the person lives in our latitude, a very severe cold climate with snow and ice for six months each year? The City of Edina is trying to be a leader in green space, vehicle emissions, narrowed streets, reduced speed limits, and seems to push theory’s that in 40 years everyone will be driving tiny electric cars, riding bicycles, taking busses, and walking to small neighborhood stores, recycling food scraps, etc. Some people may like this life style, but I for one don’t want it forced upon me. I also don’t think we should spend our tax revenue trying to convince people like me that this is the right plan. Respondent No:19 Login:lewi0392 Email:lewi0392@gmail.com Responded At:Mar 27, 2021 14:54:14 pm Last Seen:Mar 27, 2021 21:29:01 pm IP Address:74.81.184.6 Q1.First and Last Name Andrew Lewis Q2.Address 6117 St Johns Ave, Edina, MN 55424 Q3.Comment This is a timely and worthwhile effort on the part of the city to reconsider parking in the context of climate change, transportation patterns, and current development trends. Mandating parking when market forces do not demand it drives up the cost of housing and business development in a time in which both are acute issues. I support these efforts and hope that the project team can come up with an approach that considers the costs and benefits of parking more equally than they have been to this point. Respondent No:20 Login:modern dad Email:tcarlson@carlsonpartnersllc. com Responded At:Apr 06, 2021 07:23:17 am Last Seen:Jul 12, 2021 14:42:55 pm IP Address:96.67.189.61 Q1.First and Last Name Ted Carlson Q2.Address 5516 Knoll Drive Q3.Comment As a 20 year resident and local developer, I am excited that Edina is updating a code that is 50 years old. Focus on transit, ride-share, bikes and pedestrians is very important! Let's figure out how to get rid of huge parking lots that are misaligned with market demands. Respondent No:21 Login:Anonymous Email:n/a Responded At:Apr 10, 2021 12:39:40 pm Last Seen:Apr 10, 2021 12:39:40 pm IP Address:n/a Q1.First and Last Name Chris Brown Q2.Address 4504 West 70th Street Q3.Comment This is definitely a step in the right direction! Unfortunately, this feels like a small step instead of broader change. Especially if we hope to create meaningful change regarding how residents, employees, and visitors travel throughout Edina. The E Line, Green Line extension, and improved bike/ped connections, as well as more mixed-use and dense development planned for parts of the City could all create significant opportunity for parking space reductions. I urge you to consider going further with this in mind. I'm not advocating for removing minimums altogether (at least not right now), but continuing to require 1:1 minimum ratios coupled with minor increases in square footage requirements feels like this opportunity is missing the mark. Edina is not an exurb. It's a first ring suburb with significant built environment benefits that provide a foundation for greater mode shift away from single family vehicles. Key items for your consideration: Sec 1.b: 1.25 space min. for multi-family housing, especially when most of that will be in transit-served areas seems unnecessarily high. Could we consider a 1:1 at the very least? Sec 1.g: Why require two spaces per classroom when students cannot drive anyway? I understand parent or volunteer activities but as an advocate for safe routes to school, let's think bigger. Sec 1.h, k, m, and v: All of these have minimal increases in square footage. Can't we do more? I'm not a parking expert but increasing by 50 sq ft seems paltry. Sec 1.w: This is probably the biggest disappointment. 1:1 for a mixed-use development when this development is likely located near the most desirable multimodal connections? Couldn't we at least try 0.8 minimum and 1.25 maximum? Do we really need three spaces for every two units? I've parked in the Westin's parking garage and it's an excellent example of wasted space (and money). Sec 2 (all): Three of the four PCDs will be served by the E Line. All of these represent the greatest opportunity for Edina to aggressively promote mode shift away from SOVs. In addition to reducing the minimum, these areas would be great locations to promote affordable housing via reduced parking costs. Sec 3: Could a provision to promote affordable housing be included? This policy seems like an excellent opportunity to provide developers with the tools to incentivize inclusion of affordable dwelling units within a broader project or fully- affordable buildings. There are examples of other municipalities using parking policy to accomplish this, so I strongly recommend your review and consideration. We are in the midst of an affordable housing crisis and as a City with many food service, retail, and other traditionally low-wage industries, wouldn't it be great to have these workers have at least the option to live closer to where they work? Parking costs a lot to build, and that cost usually ends up raising tenant rents. $5,000: Cost per surface space $25,000: Cost per above-ground garage space $35,000: Cost per below-ground garage space $142: The typical cost renters pay per month for parking +17%: Additional cost of a unit's rent attributed to parking Thank you for your consideration of my comments! I'm pleased to see the City considering this step in the right direction but I know we can do more! Respondent No:22 Login:Anonymous Email:n/a Responded At:Apr 13, 2021 07:30:00 am Last Seen:Apr 13, 2021 07:30:00 am IP Address:n/a Q1.First and Last Name your mom Q2.Address your mom Q3.Comment your mom Respondent No:23 Login:Anonymous Email:n/a Responded At:Apr 13, 2021 07:33:28 am Last Seen:Apr 13, 2021 07:33:28 am IP Address:n/a Q1.First and Last Name Your mom Q2.Address The DEEZ NUTS Rood Q3.Comment its free real estate Respondent No:24 Login:Anonymous Email:n/a Responded At:Apr 15, 2021 06:55:42 am Last Seen:Apr 15, 2021 06:55:42 am IP Address:n/a Q1.First and Last Name Thomas Hoegh Q2.Address 4407 Grimes Ave. S Q3.Comment "If you don't build it, they will still come." - this should be the city's motto regarding parking. The city's 'logic' to reduce parking is reductive. In other words, there is a desire to reduce parking space so they spin explanations and scavenge for data to support that position. This is really, really sad that idealogues are driving public policy. Respondent No:25 Login:Anonymous Email:n/a Responded At:Apr 20, 2021 12:43:53 pm Last Seen:Apr 20, 2021 12:43:53 pm IP Address:n/a Q1.First and Last Name Mic O’Brien Q2.Address 4052 Sunnyside Rd Q3.Comment This sure feels to me like a developer who knowingly built his new building (The Lorient) with insufficient parking, with the knowledge that he would eventually get his way. His subsequent variance request was (somewhat, surprisingly) turned down; however, his new angle is to just get the rules changed. That way, he gets the rent from the large restaurant that he always planned on, the city gets the tax revenue and the surrounding neighborhood takes the brunt of the street-parked cars. Some of my neighbors warned me that this was inevitable — they’ve given up the fight. I guess the city & developer “win”? Respondent No:26 Login:Anonymous Email:n/a Responded At:Apr 22, 2021 09:45:57 am Last Seen:Apr 22, 2021 09:45:57 am IP Address:n/a Q1.First and Last Name Roberta Castellano Q2.Address 4854 France Ave S Q3.Comment I object to any plan that will increase the likelihood of commercial district parking spilling out into the surrounding neighborhoods, reducing the neighbors’ quality of life, and fundamentally and detrimentally altering the character of the surrounding neighborhoods, while simultaneously reducing developers’ required investments into projects. This plan appears to be consistent with City efforts to expand commercial areas into surrounding neighborhoods. At 50th & France, it was discovered during the 50th & France Small Area Planning, that the City had been intending to utilize Eminent Domain, and the City was subsequently found to have inserted into the 50th & France Small Area Plan, an extortion scheme to extract property holdings from Maple Road neighbors, in order to further enable Lunds to redevelop the US Bank site to a greater extent than otherwise possible. This was in addition to multiple underhanded attempts to increase the permitted housing unit density within the district. Respondent No:27 Login:jjan Email:jjanovy@outlook.com Responded At:May 20, 2021 11:26:21 am Last Seen:May 20, 2021 11:26:21 am IP Address:n/a Q1.First and Last Name Jennifer Janovy Q2.Address 4016 Inglewood Avenue Q3.Comment Here are initial comments: -- I have submitted questions asking where standards can be found for electric vehicle chargers and parking design. -- What is the thinking behind parking maximums? Is this to prevent the city from imposing more parking than needed or to prevent developers from proposing more parking than the city wants the development to have, even though a developer is unlikely to propose any more than it needs? --The code revision allows a 10% reduction in parking if the development is within one quarter mile of a transit stop. I live within one quarter of a mile of qualified transit stops, but still need a place to store my car. If there is local data to establish a finding that when people live or work within a quarter mile of a qualified transit stop they will not own or use a car but will take transit instead, then fine. If this idea is derived from experiences in much denser urban areas or if it stems from a belief that we can get people to drive less or take transit more if we undersupply parking in our community, then no. --The revision allows for up to a 5% reduction in spaces "for any development that provides reserved parking for use by car-share vehicles." How many reserved parking spaces for car-share vehicles? Is it one-for-one? The code doesn't make that clear. There are no Zipcar or Hourcar locations in Edina (based on google search). Let's think about this. If it's a commercial space, customers are coming and going. It makes no difference whether the vehicle they use is their personal vehicle or rented. Parking needs don't change. If it's a multifamily use, the rented vehicle may be a second or third vehicle for the tenants. They still need their regular space(s). --The revisions allows up to a 10% reduction in parking requirements if the parking area uses pervious pavement or provides a storm water facility. It allows up to 20% reduction if the design allows for retaining trees or native landscaping. What do either of these provisions have to do with parking utilization? Is the assumption that the code minimums in other sections still require too much parking and so it can be reduced another 10-20%? Do trees and stormwater facilities mean fewer people will need to park their cars? There are tree, landscaping, and stormwater requirements in other sections of the code. If these are not adequate, make them better. Put the "park" in parking lot (surface lots should be green) as a mandate. --Parking stalls are for storing vehicles when they are not in use. Although parking areas are not typically designed very thoughtfully for pedestrians, they are as much pedestrian environments as they are vehicle environments. The number of stalls is only one aspect of parking area design. Other areas include stall size, drive aisles, car, pedestrian and bike circulation, lighting, and other functions that might be served by a parking area, such as idling areas for delivery vehicles and ride share pickup/drop off, electric vehicle charging, waste storage and collection, and snow storage. How well a parking area functions depends on the whole picture, not only the number of stalls. Does the code address the whole picture? If yes, we should review the code revisions within this larger context. --A parking area that functions poorly can have a negative impact on adjacent streets and other properties. Trucks double parking for deliveries or waste removal, vehicles circling the block or hovering to find a parking spot, commercial or multifamily residential parking intruding on R-1 neighborhoods. People tend to look at parking areas as wasted space. It costs a lot and is not revenue generating (for the most part). But providing adequate space within parking areas is absolutely necessary to reduce spillover impacts. --I chose my neighborhood because of its proximity to stores, restaurants and services that I can walk to. For over 20 years I regularly took trips on foot, walking to the grocery store, restaurant or Target. Then I fell on the ice three times in the winter even though I was wearing spikes. Last winter I broke my ankle and couldn't walk (or drive) until late May. Not everybody can walk or bike or easily take transit, for a lot of reasons. Some community design ideals are about taking away choice. If you make it difficult to find a parking space by reducing parking requirements, more people will walk, bike or take transit. That is creating one hardship to create another. For many people, having to walk, bike or take transit is a hardship. For me, it was (and is) a lifestyle choice, but not all the time. My time on the transportation commission and Bike Edina, spearheading the France Avenue pedestrian project, Living Streets policy and pedestrian plan, was about expanding people's transportation choices. I believed there was an unmet need for sidewalks and safe crossings. Uber/Lyft have shown there is a need for ride share services. Tesla, Volvo, Ford and other car companies are leading the way on electric vehicles. If we listen, people tell us how they want to live. Other than ideologues and cost-wary developers, I don't hear anyone saying they want less, or less convenient parking, in new developments. Crowded, inadequate parking areas don't add to anyone's quality of life. So, please, think carefully about the beliefs or assumptions underlying some of these parking code changes. --Thank you for considering. Jennifer Janovy Respondent No:28 Login:Anonymous Email:n/a Responded At:Jun 07, 2021 17:53:28 pm Last Seen:Jun 07, 2021 17:53:28 pm IP Address:n/a Q1.First and Last Name Paul Thompson Q2.Address 4244 Crocker Ave Q3.Comment do everything you can to increase walking, bike parking and getting people out of cars and using public transportation or biking and walking.....thanks for your attention to this climate solution. Respondent No:29 Login:Anonymous Email:n/a Responded At:Jul 07, 2021 21:43:00 pm Last Seen:Jul 07, 2021 21:43:00 pm IP Address:n/a Q1.First and Last Name K Curtin Q2.Address 5525 Code Ave Q3.Comment The majority of residents use cars to get around and having adequate parking both on city streets and businesses is vital to continued long term success of the city. If you leave it up to developers they will lie and exaggerate to maximize profits and say parking should be reduced. We NEED to continue to have adequate parking to continue our quality of life and for ongoing access for our residents. Failure to have adequate parking will drive away businesses who can't turn a profit due to no parking for customers and drive away older residents who cannot get to needed businesses when both vital to our community. Please do NOT reduce our parking requirements in the city of Edina. Respondent No:30 Login:rodscholl Email:rod.scholl@gmail.com Responded At:Jul 09, 2021 08:08:11 am Last Seen:Jul 09, 2021 15:05:52 pm IP Address:68.54.106.88 Q1.First and Last Name Rod Scholl Q2.Address 4217 W. 42nd St. Q3.Comment This is a giveaway to the wealthy; a wolf in green sheep’s clothing. The day the city lowers the parking requirements commercial land values will pop up like, let’s say 15% because the potential for the property is much greater now that the city is giving them our streets for their parking lots. It’s true the tax revenue now goes up, let’s say like 1%... and the wealthy get a lot, and residents get a few crumbs. Of course, those numbers are total guesses because the city is not providing that analysis on BetterTogether. The lack of discussion of the actual motivation makes this seem like an attempted sleight of hand. And the winner will be the developers and commercial property owners… and we residents will have a little more enjoyability and ease of life chipped away from us so that they can turn bigger profits. I’m not much of a historian, but even I can see the pattern here from leadership.***************** It remains unanswered how much a typical residential property tax would be reduced in exchange for this parking deal (or what services could be added). If you saved me $5,000 a year in property taxes, then maybe it’s worth the hassle of fighting like vultures for parking. If you save me only $5 a year in property taxes – I’d rather pay the $5 and not be circling in my car creating pollution/emissions while looking for spots in winter’s slush, and trudging along streets with no sidewalks. ************** Also missing is an assessment of whether we have excess parking now. If that is a known fact, publish the data of lot usage. It seems like every category had decreased parking requirements, perhaps excepting restaurant parking. **************** It’s audacious to claim this is a green approach, while the commercial land owners get a lowly taxed windfall to produce more stuff and waste and energy use. Using inconvenience to discourage driving is akin to scattering nails in the roadways -- which might be supported by tire manufacturers, just as this proposal is supported by developers. ************* Would we be better served to reduce the parking, and put a large tax on that change for associated commercial property value increases… and that tax is used to subsidize better car sharing options, mass transit, electric vehicle subsidies, etc? Why is the strategy to give away money to commercial land owners and developers so that we get a few scraps in exchange? ************** If we are desperate for the tax revenue – where is that analysis and discussion? If you came up to my property and said you wanted to have the option to park your cars on it permanently – I would of course ask how much you’re going to give me for that in exchange. And it would depend on how often that spot would be filled. Are we talking a Red Cow situation, or is this just less blacktop sitting unused that we may as well get rid of? And if it is indeed a current excess in parking, why would parking requirements be so much less in Edina than all the surrounding areas? Edina currently has typical parking requirements compared to the 24 surrounding areas, and looks like the new ordinance roughly cuts the requirement in half (once you add in modifiers for bus lines and bike racks, etc.) **************** If one reviews the provided “Parking Regulations for Municipalities within the Twin Cities” it’s clear Edina is proposed to have quite a bit less parking than neighboring cities (other than restaurant parking). If you add in 10% decrease for being near a bus line, (not even counting the additional 10% decrease for merely having a bike rack) it’s clear that Edina will have the least amount of parking compared to the 24 other cities listed in nearly every category. Note the lists shows current, not proposed requirements. And also not shown is the decreasing modifiers for bus lines and bike racks which could be another 20% or even more reduction in parking requirements). When I do that comparison, Edina is *dead last* in most categories for amount of parking required. For example, the summary in the February 24th memo shows that the typical decrease is going from 1/200 to 1/350. If you include the 10% modifier for bus lines, and 10% modifier for a bike rack, we’re up to 1 spot per 424, which is less than half the original ordinance. Therefore, the “half the parking” assessment seems fair. (Again, excepting restaurant parking, which is hard to evaluate given the change in metrics, but still looks typical-ish.) ******************** A tally was done by the city as requested by MNA which proves this “half the parking” assessment out (see here http://www.edinamorningside.org/news on July 7). Note this tally doesn’t include the many possible modifiers that *further* reduce parking requirements. ********************* Looking outside the region, the comparison cities provided by Nelson Nygaard seem cherry picked. No justification for their selection is given. Why demonstrate that we’d be similar to Charlotte, NC which has 15X the population of Edina, a skyscraper-filled skyline and a 75,000-seat stadium? And Highland Park, IL used for comparison is a beach community, and we all know what parking is typically like near the beach given the different land value. The other two cities, Dublin and Birmingham, seem like better comparisons; and I note on a quick review they seem to have almost twice the parking in most categories compared to the 2-24 draft regulations for Edina. Is the point of these comparisons to illuminate that Edina will feel like trying to park in a downtown, or beach community, as opposed to a typical suburb? Again, there is no analysis or conclusions -- just photocopies from four cities ordinances without justification for their inclusion, or why Edina should have parking like downtown Charlotte (or even *less* parking than Charlotte in many categories, actually.) ***************** The arguments for "potential" benefits are listed -- so why not list the many “potential” drawbacks as well? No analysis is given on whether those potential benefits will come to fruition. My economic theory says that existing land values will immediately pop-up after the passing of this ordinance, because builders can put more on them. That windfall never makes it to the affordable housing category. Land is worth more, builders make more, and tax revenues go up – why would that result in lower cost per unit? With the complexity of economics related to affordable housing, we need more than a list of benefits it “may” include. Your new car “may” get great gas mileage… but shouldn’t an estimate of the mileage be listed on the window when you’re shopping?**************** We can agree that too much parking wastes land, and too little parking creates congestion, and is undesirable to those currently living nearby (e.g. Red Cow). Yet, the provided information does not aid the decision or demonstrate the wisdom of the proposal. Looking closely, it seems to actually refute the change in ordinance given that comparative cities have will have twice the parking as Edina. The inflammatory language, and reactionary graphics in the presentation is noted, and given the lack of data or logical arguments, I fear we have paid for propaganda. Worse I fear the motivations of those who have selected that vendor. And even worse, having received the product, I fear those that subsequently approved it as a helpful tool in this discussion and decision making. ************************* For example, on Page 3 – Nygaard argues that, like free pizza, demand for parking is endless -- a false equivalency (and a poor one, because actually people do get full on pizza eventually!). And on Page 6 -- some random city chosen without explanation... no source of the data -- and only concluding that Portsmouth, NH might not know how much parking they have. Are they suggesting every other city also doesn’t know how much parking they have, and so should have less? And we must also be in that same boat? Better, would be an assessment of whether or not there is a unused parking in Edina, and if so at what types of establishments. If that data exists, it is a major oversight to not have published it. ********************* Or, how about data on impacts in municipalities before and after parking ordinance changes – such as associated change in value of nearby residential property values – and increased or decreased commerce and revenues? Or data on whether housing/space was actually made more affordable, or if merely more units were added to increase builder/land owner profits. Also, cruising for parking creates *more* congestion and pollution and is hard to estimate but could be 15%-30% https://www.parkingtoday.com/articledetails.php?id=2624&t=is-30-percent-of-traffic-cruising-for-parking). What are parking needs compared to supply currently in Edina, and what would it be 20 years after the proposed changes? How can our leaders make this decision if the advisors are propagandists -- and how can you expect the public to support it, when they are presented with biased and poorly argued information? ******************** This proposal is basically selling our city streets for future parking usage, so the developers can make more dollars when they develop existing land. It will be gradual, and it's true that the city gets a cut, eventually, via tax revenue on the increased land use. And maybe we need the money for services, and this is the best way to get it at the least inconvenience to we residents. But no such argument is made. Therefore, given complete avoidance of the issue of parking vs. developer profits which historically seem to drive Edina city decisions… and also it strangely leaves obscure the dramatic *decrease* in proposed amount of parking relative to neighboring cities… it sure sounds to me like something is rotten in the state of Denmark. Respondent No:31 Login:Anonymous Email:n/a Responded At:Jul 12, 2021 09:49:53 am Last Seen:Jul 12, 2021 09:49:53 am IP Address:n/a Q1.First and Last Name Roberta Castellano Q2.Address 4854 France Ave S Q3.Comment Monday, July 12, 2021. The City of Edina proposes to reduce required parking at 50th & France in spite of the current conditions. I believe that this is wrong-headed, and that the proposed changes have the potential to further erode the qualities of 50th & France that have made it so unique and appealing for so many years. Nolan Mains was for the most part completed in 2019. Yet, the retail is only about half leased, if that, including the North Ramp commercial. And it is my understanding that at least some of those vacancies have been filled through lease concessions. There remain long- standing vacancies on 50th Street. The Edina Theatre has now closed for good. At the 5000 France building, the corner anchor is gone, accompanied by vacancies at 5014 and 5018 France. How is reducing the available parking going to help the commercial district? How are you going to bring people back to 50th & France? Maybe you don’t want those people. Make it more urban, stuff it with residential, attract a different crowd, more like Uptown, or Downtown? Yes, you can do that, and that is the direction the City has been going in. But that is already making for a very different 50th & France, more like an appendage of Minneapolis. Why come to 50th & France? Nolan Mains is a very attractive building at ground level. But together with the North Ramp, the Market Street redevelopment was a game-changer for 50th & France, as it has changed the character of the area by urbanizing it. How to describe? Narrow, close, keep moving, dark, secreted, a plaza in a pit, ultra-urbanized, hidden, reduced availability of quick parking. A couple of waiting spots is all people get. The first time I checked out the parking underground at Nolan Mains, I saw a smashed window on a vehicle, and the driver on her cell phone (She said she was ok.) The interior of the North Ramp is dark. The new green wall grill on the face of the North Ramp is rusting, and the greenery looks like a few weeds in a vacant parking lot, only on a vertical plane, instead of horizontal. Market Street looks like it is in a downward spiral. How is reducing required parking going to fix that? The Market Street redevelopment established precedents for Lunds to insert high density buildings, and push even further with height, in advance of the long-since-announced intent to redevelop the US Bank Site and US Post Office. According to a traffic study that the City hid from the public-- never publicly vetted--and then snuck into the Comp Plan decennial Update submittal to the Met Council on 12-31-2019, the City has been considering at least another 200 housing units on these sites. And that would be in addition to the grocery store relocating to this area from south of 50th Street. Is the City seriously intending to rid 50th & France of a full-service US Post Office and send even more people to St. Louis Park? The City also secreted into the 50th & France Small Area Plan (2018-2019), an attempt to evade Minnesota statutory prohibitions on the use of Eminent Domain, through the use of an extortion scheme to wrest property from Maple Road homeowners along the perimeter of the US Bank Site, in order to enable Lunds to construct a larger development than would otherwise be possible. The City further expressed interest in making people pay to park! Another nail in the coffin, please? Let us not forget, the City has considered using Eminent Domain to bust the boundaries of the 50th & France Commercial District into the surrounding White Oaks neighborhood. This was verified through a public data request under Minnesota Statutes! And then there is TIF. The costs to redo the public parking in the Market Street project are being borne by the taxpayers through TIF. In the 50th & France Small Area Plan, it was stated that the City might rebuild the South Ramp parking with even more public support, and is even eyeballing nearby residential (much of which was misrepresented, by the way, along with numerous other misrepresentations in the 50th & France Small Area Plan). That sounds to me like even more intent to use Eminent Domain! Through the proposed amendment to the zoning code, the City of Edina wants to reduce the burden on commercial even further, and reduce number of parking spaces required to be provided by businesses. There is nothing that says that the City must revise and reduce parking requirements now at 50th & France. The most likely but unstated reason seems to me to be that it is another preparatory step that the City wants to implement now, in advance of a formal submittal by Lunds for the redevelopment of its property holdings at 50th & France, and not just the US Bank and US Post Office sites. Nevertheless, any code reductions would apply to all businesses, isn’t that correct? Relegate much of the public parking to the surrounding neighborhood streets, right? It is my opinion that the proposed reductions at 50th & France are a bad idea, and I hope that the City Council will vote it down. Thank you. The CITY ofEDINA Zoning OrdinanceAmendment – Off-Street Parking Regulations The CITY ofEDINA EdinaMN.gov 2 Use Current Ordinance 1-27 DraftRegulation Proposed Ordinance Apartments 2.0 spaces per unit 1.25 spaces per unit minimum 1.25 spaces per unit minimum with a 1.75 space per unit maximum Nursing Home One space per 4 patients or residents One space per 4 patients or residents One space per 5 patients or residents Community Center One space per 200 s.f. One space per 200 s.f. One space per 250 s.f. Medical, dental, clinic & animal hospital One space per 200 s.f. One space per 250 s.f. One space per 300 s.f. Restaurant 1 space per 3 seats One space per 100 s.f. plus one space per 150 s.f of outdoor space One space per 100 s.f. no requirement for outside seating Office Formula based on size One space per 250 s.f. One space per 300 s.f. with a max of one space per 200 s.f.(generally one space per 200 s.f. Residential use in a Mixed Development District 1.75 spaces per unit 1.25 spaces per unit minimum 1.0 spaces per unit with a maximum of 1.5 spaces per unit Residential use in a Planned Commercial District 1-1.5 spaces per unit depending on unit size 1.0 spaces per unit minimum 1.0 spaces per unit with a maximum of 1.5 spaces per unit Officeuse in a Planned Commercial District One space per 200 s.f. One space per 300 s.f. One space per 350 s.f. with a maximum of one space per 200 s.f. Shopping Center within a Planned Commercial District One space per 200 s.f. One space per 300 s.f. One space per 350 s.f. Project Examples Current Ordinance Proposed Ordinance 4500 France Restaurant Proposed (Variance was denied by the City Council) Examples are based on the square footage of the space available. 100 seat restaurant (3,700 s.f.) = requires 43 spaces required 3,700 s.f. restaurant = 42 spaces required (using the 10% reduction - transit stop) This project did not meet the current ordinance and would not meet the proposed ordinance 70th and France Retail (50,000 s.f) & Office (140,000 s.f.) = 1,006 spaces Residential = 379 enclosed spaces 1,385 spaces total required Retail (50,000 s.f) & Office (140,000 s.f.) = 702 spaces Residential = 341 enclosed spaces 1,043 spaces minimum required; and 1,411 maximum spaces allowed) (1,170 stalls are proposed – meets the proposed ordinance) 6950 France (New Furniture Store) 10,000 s.f. of retail = 62 spaces required 10,000 s.f. of retail = 40 spaces required (51 spaces were installed – meets the proposed ordinance, variance was required under the existing ordinance) Amundson Flats (70th and Cahill/Amundson) 62-unit apartment 2 spaces per unit (1.25 enclosed) 124 total required (77 enclosed) 62-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 77 total minimum spaces required; and 109 maximum spaces allowed (62 enclosed) (94 stalls total, 62 enclosed approved – meets the proposed ordinance) Aeon Housing Project (76th Street) 70-unit apartment 2 spaces per unit (1.25 enclosed) 140 total required (70 enclosed) 70-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 70 total minimum spaces required; and 123 maximum spaces allowed (70 enclosed) (87 stalls total, 64 enclosed approved – meets the proposed ordinance) Hazelton Apartments 185-unit apartment 2 spaces per unit (1.25 enclosed) 370 total required (185 enclosed) 185-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 231 total spaces required; 324 spaces maximum allowed (185 enclosed) (277 stalls enclosed approved – meets the proposed ordinance) 7200-7250 France Development (approved by never built) 309-unit apts.-2 space per unit (1.25 enclosed = 618 spaces 30,000 s.f. retail/office = 146 spaces Total Required = 764 spaces 309-unit apt.-1.25 spaces per unit (1 enclosed) & 1.75 maximum = 386 total required & 540 max. (309 enclosed) 30,000 s.f. retail/office = 120 spaces Total Required = 506 spaces minimum required and 660 maximum allowed (590 stalls approved, with 540 underground – meets the proposed ordinance) Avenue on France (project denied by City Council) Mixed Use District Nonresidential = 1/300 s.f. (708,348 s.f.) 2,361 spaces required Residential = 1 enclosed space/unit (239) + .75 spaces exposed per unit (179) 418 spaces required 2,779 total spaces required Mixed Use District Nonresidential = 1/300 s.f. minimum and 1/200 maximum (708,348 s.f.) (10% reduction – bus stop) 2,125 spaces required & 3,188 max. Residential = 1 enclosed space/unit minimum and 1.5 spaces maximum (239) 215 spaces minimum required and 358 maximum (Council could add spaces if necessary) 2,340 minimum total spaces required and 3,546 maximum allowed – 2,873 spaces proposed therefore would have met the proposed ordinance The CITY ofEDINAOptions EdinaMN.gov 5 1.Grant first reading of Ordinance No. 2021-07 (with and recommended changes.) 2.Approve Ordinance No. 2021-17 and waive second reading Parking in Edina By Lou Miranda & Kate Agnew – 19 July 2022 Planning Commission Presentation To Edina City Council Goals Sustainability • Climate Action Plan: Reduce VMT, increase transit: A city gets what it builds for Equity & Affordability of housing • Parking mandates drive up cost of housing Local economy • Walkable neighborhood nodes with retail & dining build community, tax base Children • Reduce congestion, ensure children & families are safe in neighborhood nodes Strategy Tell a Story •Edina started as a streetcar suburb; what kind of future do we want for our children? (Pages 3 through 8 of Nelson\Nygaard report) Big Picture •Comp Plan: planning, housing, transportation, & equity require an integrated plan (page 23 of Nelson\Nygaard report) Multiple Steps •Phase in ordinance changes (pages 9 through 29 of Nelson\Nygaard report) Communicate Benefits • Parking Benefit Districts vary by neighborhood node: “Your neighborhood isn’t Southdale” (page 20 of Nelson\Nygaard report) Results Collaboration •Planning & Transportation Commissions working together Plans •Off-street parking ordinances •On-street parking management plan (page 31 of Nelson\Nygaard report) •City-wide transportation plan integrating walking, biking, transit, & cars Edina as a Leader •A first-class community that is attractive to the amazing new families that move here Phases with Scale-of-Change Examples Short Term A.High: Remove all parking minimums B.Medium: Reduce all parking minimums C.Low: Reduce some minimums Medium Term A.High: Parking caps/ maximums (page 26 of Nelson\Nygaard report) B.Medium: Remove parking minimums; add parking benefit districts C.Low: Reduce all parking minimums Long Term A.High: transformative change (UN IPCC report) B.Medium: City-wide transportation plan; parking maximums C.Low: Parking benefit districts Phases with Scale-of-Change Examples Short Term A.High: Remove all parking minimums B.Medium: Reduce all parking minimums C.Low: Reduce some minimums Medium Term A.High: Parking caps/ maximums (page 26 of Nelson\Nygaard report) B.Medium: Remove parking minimums; add parking benefit districts C.Low: Reduce all parking minimums Long Term A.High: transformative change (UN IPCC report) B.Medium: City-wide transportation plan; parking maximums C.Low: Parking benefit districts This ordinance The CITY ofEDINA Zoning Ordinance Amendment –Off-Street Parking Regulations The CITY ofEDINA EdinaMN.gov 2 Use Current Ordinance ITE (Institute of Transportation Engineers) Parking Standard Proposed Ordinance Apartments 2.0 spaces per unit 1.3 spaces/unit -mid rise 1 space/unit -high rise 1.25 spaces per unit minimum with a 1.75 space per unit maximum Nursing Home One space per 4 patients or residents One space per 5 patients or residents Community Center One space per 200 s.f.One space per 250 s.f. Medical,dental, clinic & animal hospital One space per 200 s.f.1 space per 375 s.f One space per 300 s.f. Restaurant 1 space per 3 seats 1 space per 81 s.f.One space per 100 s.f.no requirement for outside seating Office Formula based on size 1 space per 380 s.f.One space per 300 s.f.with a max of one space per 200 s.f.(generally one space per 200 s.f. Residential use in a Mixed Development District 1.75 spaces per unit 1.0 spaces per unit with a maximum of 1.5 spaces per unit Residential use in a Planned Commercial District 1-1.5 spaces per unit depending on unit size 1.0 spaces per unit with a maximum of 1.5 spaces per unit Office use in a Planned Commercial District One space per 200 s.f.One space per 350 s.f.with a maximum of one space per 200 s.f. Shopping Center within a Planned Commercial District One space per 200 s.f.1 space per 343 s.f.One space per 350 s.f. Project Examples Current Ordinance Proposed Ordinance 4500 France Restaurant Proposed (Variance was denied by the City Council) Examples are based on the square footage of the space available. 100 seat restaurant (3,700 s.f.) = requires 43 spaces required 3,700 s.f. restaurant = 42 spaces required (using the 10% reduction -transit stop) This project did not meet the current ordinance and would not meet the proposed ordinance 70th and France Retail (50,000 s.f) & Office (140,000 s.f.) = 1,006 spaces Residential = 379 enclosed spaces 1,385 spaces total required Retail (50,000 s.f) & Office (140,000 s.f.) = 702 spaces Residential = 341 enclosed spaces 1,043 spaces minimum required; and 1,411 maximum spaces allowed) (1,170 stalls are proposed –meets the proposed ordinance) 6950 France (New Furniture Store)10,000 s.f. of retail = 62 spaces required 10,000 s.f. of retail = 40 spaces required (51 spaces were installed –meets the proposed ordinance, variance was required under the existing ordinance) Amundson Flats (70th and Cahill/Amundson) 62-unit apartment 2 spaces per unit (1.25 enclosed) 124 total required (77 enclosed) 62-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 77 total minimum spaces required; and 109 maximum spaces allowed (62 enclosed) (94 stalls total, 62 enclosed approved –meets the proposed ordinance) Aeon Housing Project (76th Street) 70-unit apartment 2 spaces per unit (1.25 enclosed) 140 total required (70 enclosed) 70-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 70 total minimum spaces required; and 123 maximum spaces allowed (70 enclosed) (87 stalls total, 64 enclosed approved –meets the proposed ordinance) Hazelton Apartments 185-unit apartment 2 spaces per unit (1.25 enclosed) 370 total required (185 enclosed) 185-unit apartment 1.25 spaces per unit (1 enclosed) & 1.75 maximum per unit 231 total spaces required; 324 spaces maximum allowed (185 enclosed) (277 stalls enclosed approved –meets the proposed ordinance) 7200-7250 France Development (approved by never built) 309-unit apts.-2 space per unit (1.25 enclosed = 618 spaces 30,000 s.f. retail/office = 146 spaces Total Required = 764 spaces 309-unit apt.-1.25 spaces per unit (1 enclosed) & 1.75 maximum = 386 total required & 540 max. (309 enclosed) 30,000 s.f. retail/office = 120 spaces Total Required = 506 spaces minimum required and 660 maximum allowed (590 stalls approved, with 540 underground –meets the proposed ordinance) Avenue on France (project denied by City Council) Mixed Use District Nonresidential = 1/300 s.f. (708,348 s.f.) 2,361 spaces required Residential = 1 enclosed space/unit (239) + .75 spaces exposed per unit (179) 418 spaces required 2,779 total spaces required Mixed Use District Nonresidential = 1/300 s.f. minimum and 1/200 maximum (708,348 s.f.) (10% reduction –bus stop) 2,125 spaces required & 3,188 max. Residential = 1 enclosed space/unit minimum and 1.5 spaces maximum (239) 215 spaces minimum required and 358 maximum (Council could add spaces if necessary) 2,340 minimum total spaces required and 3,546 maximum allowed –2,873 spaces proposed therefore would have met the proposed ordinance The CITY ofEDINAOptions EdinaMN.gov 5 1.Grant first reading of Ordinance No. 2021-07 (with and recommended changes.) 2.Approve Ordinance No. 2021-17 and waive second reading Date: August 3, 2022 Agenda Item #: VIII.G. To:Mayor and City Council Item Type: Report / Recommendation From:Cary Teague, Community Development Director Item Activity: Subject:Resolution No. 2022-62: Conditional Use Permit for Concord Elementary School, 5900 Concord Ave. Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Adopt resolution No. 2022-62 approving the conditional use permit. INTRODUCTION: Edina P ublic Schools requested a Conditional Use Permit for a small building addition to add a classroom at Concord Elementary School at 5900 Concord Avenue. ATTACHMENTS: Description Resolution No. 2022-62 Planning Commission Staff Report Applicant Narrative Engineering Review Memo Better Together Public Hearing Comment Report Proposed Plans 1 of 2 Proposed Plans 2 of 2 Site Location and Zoning Staff Presentation Better Together Report RESOLUTION NO. 2022-62 APPROVING A CONDITIONAL USE PERMIT CONCORD SCHOOL AT 5900 CONCORD AVENUE BE IT RESOLVED by the City Council of the City of Edina, Minnesota, as follows: Section 1. BACKGROUND. 1.01 The Edina Public Schools are proposing an addition to the east side of Concord School located at 5900 Concord Ave. The conditional use permit request is to add one additional SPED room, and one additional general classroom to the east side of the building. The goal of the school's addition is to support the growing SPED program at Concord, provide classroom flexibility for the school and improve accessibility to the building. The entries on the east side of the school are elevated approximately two (2) feet above the first-floor level, making entry to the school difficult for those with accessibility requirements. The accessible route added at this entry would allow opportunity to those entering the building from the parking lot, the parent drop off loop, and the playground, all of which are located on the east side of the site. 1.02 A Conditional Use Permit is required for the building addition. 1.03 The property is legally described as follows: See attached legal descriptions. 1.04 To accommodate the request, the following land use applications are requested: 1. A Conditional Use Permit. 1.05 On June 29, 2022, the Planning Commission recommended approval of the request. Vote: 5 ayes, 0 nays. 1.06 On July 19, 2022, the City Council held a public hearing on the Conditional Use Permit. Section 2. FINDINGS 2.01 Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. RESOLUTION NO. 2022-62 Page 2 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. Section 3. APPROVAL NOW THEREFORE, it is hereby resolved by the City Council of the City of Edina, approves the Conditional Use Permit for Edina Public Schools for the building addition at Concord School. Approval is subject to the following conditions: 3.01 Subject to staff approval, the site must be developed and maintained in substantial conformance with the following plans, unless modified by the conditions below: 1. The site must be developed and maintained in conformance with the following plans: Site plan date stamped, May 22, 2022. Grading and drainage plan date stamped, May 22, 2022. Landscaping plan date stamped, May 22, 2022. Geometric plan date stamped, May 22, 2022. Utility and erosion control plan date stamped, May 22, 2022. 2. A building and grading permit is required for the improvements. Compliance with the engineer’s memorandum dated June 13, 2022. 3. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. Adopted by the City Council of the City of Edina, Minnesota, on August 3, 2022. ATTEST: Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA ) COUNTY OF HENNEPIN )SS CITY OF EDINA ) RESOLUTION NO. 2022-62 Page 3 CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached and foregoing Resolution was duly adopted by the Edina City Council at its Regular Meeting of August 3, 2022, and as recorded in the Minutes of said Regular Meeting. WITNESS my hand and seal of said City this ____ day of __________________, 2022. _________________________________ City Clerk June 29, 2022 Planning Commission Cary Teague, Community Development Director Conditional Use Permit – (Concord School), 5900 Concord Ave. Information / Background: The Edina Public Schools are proposing an addition to the east side of Concord School located at 5900 Concord Ave. The conditional use permit request is to add one additional SPED room, and one additional general classroom to the east side of the building. The goal of the school's addition is to support the growing SPED program at Concord, provide classroom flexibility for the school and improve accessibility to the building. The entries on the east side of the school are elevated approximately two (2) feet above the first-floor level, making entry to the school difficult for those with accessibility requirements. The accessible route added at this entry would allow opportunity to those entering the building from the parking lot, the parent drop off loop, and the playground, all of which are located on the east side of the site. The building addition at Concord and reconfigured entrance conform to the conditional use permit requirements within the R-1 zoning district. The number of parking spaces required for the site including new improvements is 80 spaces with the site providing 118 spaces. The request requires a conditional use permit for building expansion. SUPPORTING INFORMATION STAFF REPORT Page 2 Surrounding Land Uses Northerly: ISD 273 athletic fields; zoned and guided low-density residential. Easterly: Single-family homes; zoned and guided low-density residential. Southerly: Single-family homes; zoned and guided low-density residential. Westerly: Single-family homes; zoned and guided low-density residential. Existing Site Features The existing site contains the school, parking areas, playground/athletic fields, and mature trees. Planning Guide Plan designation: Public/semi-public Zoning: R-1, Single Dwelling Unit District Conditional Use Permit Per Section 36-305, the City Council shall not grant a Conditional Use Permit unless it finds that the establishment, maintenance, and operation of the use: 1. Does not have an undue adverse impact on governmental facilities, utilities, services or existing or proposed improvements. The project would not have an adverse impact on the above. The existing utilities are adequate to serve the proposed use. 2. Will generate traffic within the capacity of the streets serving the property. The improvements would not generate any increase in traffic or increase usage of school facilities. The application would not require larger infrastructure improvements related to the streets around the school. Engineering staff has reviewed the plans. 3. Does not have an undue adverse impact on the public health, safety, or welfare. Staff does not believe the project would have an adverse impact on public health, safety, or welfare. The addition with access modifications will improve on-site safety. Engineering staff does not believe any right of way improvements would be necessary. 4. Will not impede the normal and orderly development and improvement of other property in the vicinity. The proposed improvements would not impede development in the area. STAFF REPORT Page 3 5. Conforms to the applicable restrictions and special conditions of the district in which it is located as imposed by this Section. The proposed project meets all city code provisions. Schools with building expansions and access improvements are conditionally permitted uses within the R-1 Zoning District. 6. Is consistent with the Comprehensive Plan. As mentioned previously, building expansions are a conditionally permitted use within the R-1 zoning district. The proposed use is consistent with the Comprehensive Plan. Landscaping The city forester has reviewed the proposed plan and determined the existing trees and landscaping are adequate and conform to zoning given the small addition. Grading/Drainage/Utilities The city engineer has reviewed the proposed plans and found them to be generally acceptable. An engineering memorandum is attached requesting submissions for permit application. Any approvals of this project would be subject to review and approval of the Minnehaha Creek Watershed Districts, as they are the City’s review authority over the grading of the site. Compliance Table City Standard Proposed North setback East setback South setback West setback 50 feet 50 feet 50 feet 50 feet +50 feet (existing) 370 feet (existing) 125 feet (existing) 168 feet (existing) Parking Stalls 80 stalls 118 stalls (existing) Over-story Trees trees required (number is based on the perimeter of the site) Conforming trees existing on the site STAFF REPORT Page 4 PRIMARY ISSUES/STAFF RECOMMENDATION Primary Issue Is the Conditional Use Permit (CUP) criteria met? Yes, staff believes the criteria is met. 1. The proposal meets the Conditional Use Permit findings. As demonstrated on pages 2-3 of this report, the findings for a conditional use permit would be met. 2. The proposal meets all minimum Zoning Ordinance standards. All setback requirements would be met. 3. The proposal would improve access to door openings on the site. The number of parking stalls remains in compliance the Zoning Ordinance. Staff Recommendation Recommend that the City Council approve the Conditional Use Permit for an addition to Concord school at 5900 Concord Ave. Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. Approval is subject to the following conditions: 1. The site must be developed and maintained in conformance with the following plans: Site plan date stamped, May 22, 2022. Grading and drainage plan date stamped, May 22, 2022. Landscaping plan date stamped, May 22, 2022. Geometric plan date stamped, May 22, 2022. Utility and erosion control plan date stamped, May 22, 2022. STAFF REPORT Page 5 2. A building and grading permit is required for the improvements. Compliance with the engineer’s memorandum dated June 13, 2022. 3. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. Deadline for a city decision: July 30, 2022 DATE: 6/13/2022 TO: 5900 Concord Avenue, Concord Elementary School, Development Team CC: Cary Teague – Community Development Director FROM: Mattias Oddsson, Engineering Intern Zuleyka Marquez, PE, Graduate Engineer RE: 5900 Concord Ave – Conditional Use Permit Review The Engineering Department has reviewed the subject property for pedestrian facilities, utility connections, grading, flood risk, and storm water. Plans reviewed included civil, landscape, and survey drawings stamped 5/27/2022. Note, work completed in 2021 and in progress under permits ED189263 and ED196060 includes playground updates and mitigation via a filtration basin, respectively. Review Comment Required For General 1. Deliver as-built records of public and private utility infrastructure post construction. Certificate of Occupancy 2. Maintenance of sidewalks to be responsibility of property owner. General Comment Survey 3. An existing and proposed site condition survey is required. Grading/Building Permit 3.1 Show all existing and proposed public and private easements. Grading/Building Permit Living Streets 4. Design sidewalks to meet ADA requirements. Grading/Building Permit Traffic and Street 5. Review fire access requirements with fire department. Fire truck turning template attached. Grading/Building Permit 6. (a) Concord Avenue was reconstructed in 2008. (b) School Rd and Ruth Dr were milled and overlaid in 2017. Avoid any damage. Damage to be repaired per standard plates 540 and 543 for (a) and 542 for (b). Certificate of Occupancy Sanitary and Water Utilities 7. Verify fire demand and hydrant locations. Grading/Building Permit 8. Domestic water shall be sized by the developer’s engineer. Grading/Building Permit 9. Domestic sanitary shall be sized by the developer’s engineer. Grading/Building Permit 10. Apply for a sewer & water connection permit with Public Works. Prior to Starting Utility Work 10.1 Meter required for building service line and combined lines. No meter required for fire only service line. Grading/Building Permit 10.2 Public Works to determine acceptable installation methods. Grading/Building Permit 11. Disconnected sanitary and water services to be capped at main. 12. A SAC determination will be required by the Metropolitan Council. The SAC determination will be used by the City to calculate sewer and water connection charges. Grading/Building Permit 13. Single connection from main for fire and domestic, split after main connection. Grading/Building Permit 14. Site overlaps with inner wellhead management zone. Infiltration must be outside of zone. Certificate of Occupancy Storm Water Utility 15. Provide final geotechnical report with soil borings. Grading/Building Permit 16. Local 1% annual chance floodplain with an elevation of 883.2’ located onsite. Provide the proposed lowest opening elevation for the new structure. Must not be less than 885.2’. Grading/Building Permit 17. Provide net cut/fill calculations for any grade changes below 883.2’. Grading/Building Permit 18. Provide hydraulic and hydrologic report meeting watershed and state construction site permit requirements. Note, not yet provided for this review. Applicant indicated deferred submittal (after WD has reviewed). Grading/Building Permit 19. Submit watershed district permit and copies of private maintenance agreement in favor of watershed. Grading/Building Permit Grading Erosion and Sediment Control 20. A SWPPP consistent with the State General Construction Site Stormwater Permit is required. Grading/Building Permit Constructability and Safety 21. Construction staging, traffic control, and pedestrian access plans will be required. Grading/Building Permit Other Agency Coordination 22. MDH, MPCA and MCES permits required as needed. Grading/Building Permit 23. Minnehaha Creek Watershed District permit is required. Grading/Building Permit Sustainability 24. Consider installation of electric vehicle chargers for a minimum of 5% of additional proposed parking and wiring an additional 10% for EV conversion in the future. General Comment 25. See Sustainable Design Questionnaire for additional considerations, including: • Utilize Xcel Energy’s Energy Design Assistance or Energy Efficient Buildings, and/or CenterPoint Energy’s Builder and Developer programs for this development to optimize building performance. • Install appliances and equipment that are Energy Star or EPA WaterSense certified. • Consider rooftop solar. Use UMN’s Solar Suitability map to assess solar opportunity, and the National Renewable Energy Lab’s calculator to assess solar production. General Comment Survey Responses 30 January 2019 - 11 July 2022 Public Hearing Comments-Concord Better Together Edina Project: Public Hearing: 5900 Concord Ave., Concord Elementary CUP No Responses VISITORS 4 CONTRIBUTORS 0 RESPONSES 0 0 Registered 0 Unverified 0 Anonymous 0 Registered 0 Unverified 0 Anonymous MAIN ENTRY 1111111111 -a z C7 z 54 ▪ .3=> o 0 m m -o 0 O _ fV 3> FIZ __.L_,r. 1 Tit STORAGE 111111111 • n O 0 0 O 0 0 O 0 0 O 0 0 O 0 0 O 0 0 0 ..0.0 O 0 0 O 0 0 O 0 0 0 GHI II! ,TOLL ETilr' ft_ 4 II 11 EE® +:e es,k, , e - —NM d—b cElp dTh d_PQ3 qp 4 4 CREWED LEARNNG 0 112 i il N 1 N 7 I i M111•111111 ty 'II 1 ISD #273 2023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONS May 27, 2022 UPPER LEVEL FLOOR PLAN 1" = 40'-0" 0 30' 60' 5/26/2022 3:53:48 PM BIM 3601/2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Centralsvt BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _2021 Central.rvt CONCORD UPPER FLOOR PLAN CUP CC A1.2 North Comm No: 222005/222026 11\131ALLI:1c/d7C.1 9NININV1d VNIOg dO A113 IMI•M•111•11.1••••11 22E211111111--1==. Nom WAN" N' I IP I. IN I 41 -I' t II I iJ COPING TO MATCH EXISTING BRICK TO MATCH EXISTING SPANDREL GLASS GLAZING LOUVER STRECH COARSING TO MATCH EXISTING LOUVER SPANDREL GLASS GLAZING ISD #273 2023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONS May 27, 2022 1 1 1 II III III 11 III III -I I 1— —1 I I-1 1 1-1 I I-1 I I —I I ILI II1 III 11 I- -I I II 1 1 II III III 11 III III II II 1-1 -111 I I I I-I 1=11 =I 1=-1 III III III III III III III III II III-1 EAST SIDE ELEVATION 1/8" = 1'-0" 0 6' 12' COPING TO MATCH EXISTING T BRICK TO MATCH EXISTING LOUVER 1111•••n•••11•11•Er ••=•••10=', N••••••••,- 111 1= =III 11 1 1 1 1111 1 I I 1 1 11 111111 111 III 111 11 1 1 1 1 1 =1II 1—III— II NORTH SIDE ELEVATION 1/8" = 1'-0" 0 6' 12' 5/26/2022 3:53:46 PM BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Centratryt BIM 360i//2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.M CONCORD NEW BUILDING ELEVATIONS CUP CC A2.1 Comm No: 222005/222026 m: ...sams•aous.amaaa.. ...,..........,— • 71 •..' ' =•••••••••• =MIMNI•ellnal: _----- ---- ------ 3 71 ------- •n•••••e_ =1.•11•011•Mise -----.,- 3 MMO=11111••••••6 •••••1•11•1•1•NE_ A •IIMINI, 3 : sommonammimr ammmmmmm 3 , ----- ----- - - 11•10, =mom! Elow.... MN A MINNENIMI ••••••••1••••••• isi ...„,,, MIMMINIII•••• 1 7 r.........-- .11.,..... .. ..' . : ., •. ....- . ...._ • 0111•11•11•Mc__ =0---- ---_ =----- -- ----- • ----- w._._.....---.- - -- -ii.----- . ----------- _ -- 011•1•11•1•0•01n1110, • = —MIIMMIN •C =M••••1111 a •1•••1••••c • 11•1•11/1181•1•••r_ =EMM IMm= a MIIMMIMMIMMOr. r•IMMIIMMIMIE M A 'IM••••••••nr•=r II =•c_ 11•1•11•1•1v • 0=11NEI • N•111•1c,- IMIMIII•MIE•1 .1•11•0•1•1r- ... ••11=1•1•1•1•11• ME IM•=11r. ••11•1•1•1••••11•1=1 • =•••••, .1 11•11•11OMENG 11•1•1•••••••11•110•• AM ..= = • M•11•NEMMI, •111•1•111•••••••••• A ••••Iiv. • -- M.MEM,- .......e_ . 11M15•••••.: - ----- ----- _ .1 =--- ONIIIIIIMMION 111: I= mm[swerr INIMIMEME: • •Iffle.=M=MC 111 iIr III 1 11 1 I I I I 1 SPANDREL GLASS GLAZING STRECH COARSING TO MATCH EXISTING WU 1111.11M I ir VNICI3 JO AllO IN3W.LEIVd711 5.1^wqr\rtrld ISD #273 2023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONS May 27, 2022 LOWER LEVEL FLOOR PLAN 1" = 40'-0" 0 30' 60' IE!)I North Comm No: 222005/222026 5/26/2022 3:53:46 PM BIM 3601/2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvt BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvt CONCORD LOWER FLOOR PLAN CUP CC A1.1 Edina, Hennepin, MetroGIS | © WSB & Associates 2013, © WSB & Associates2013 Concord School - 5900 Concord June 23, 2022 1 in = 752 ft / Edina, Hennepin, MetroGIS, Edina, Hennepin, MetroGIS | © WSB & Associates2013, Hennepin County, Edina, © WSB & Associates 2013 Concord School - 5900 Concord June 23, 2022 1 in = 376 ft / Edina, Hennepin, MetroGIS | © WSB & Associates 2013, © WSB & Associates2013 Zoning Map (R-1, Single Dwelling Unit District) - 5900 Concord Legend June 23, 2022 1 in = 752 ft / The CITY ofEDINA Conditional Use Permit –Edina Public Schools (Concord) The CITY ofEDINA EdinaMN.gov 2 The CITY ofEDINA EdinaMN.gov 3 The CITY ofEDINA EdinaMN.gov 4 The CITY ofEDINA EdinaMN.gov 5 The CITY ofEDINA EdinaMN.gov 6 The CITY ofEDINA EdinaMN.gov 7 The CITY ofEDINA EdinaMN.gov 8 The CITY ofEDINA EdinaMN.gov 9 City Standard Proposed North setback East setback South setback West setback 50 feet 50 feet 50 feet 50 feet +50 feet (existing) 370 feet (existing) 125 feet (existing) 168 feet (existing) Parking Stalls 80 stalls 118 stalls (existing) The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 10 1. The Conditional Use Permit criteria is met. a) Does not have an undue adverse impact on governmental facilities, utilities, services or existing or proposed improvements. b) Will generate traffic within the capacity of the streets serving the property. c) Does not have an undue adverse impact on the public health, safety, or welfare. d) Will not impede the normal and orderly development and improvement of other property in the vicinity. e) Conforms to the applicable restrictions and special conditions of the district in which it is located as imposed by this Section; and f) is consistent with the Comprehensive Plan. The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 11 2.The proposal meets all minimum Zoning Ordinance standards. All setback requirements would be met. 3.The proposal would improve access to door openings on the site. The number of parking stalls remains in compliance the Zoning Ordinance. The CITY ofEDINAStaff Recommendation EdinaMN.gov 12 Motion to close the public hearing at noon on July 25, 2022, and continue action to the August 3 City Council meeting. The CITY ofEDINA EdinaMN.gov 13 The CITY ofEDINAStaff Recommendation EdinaMN.gov 14 Recommend that the City Council approve the Conditional Use Permit for an addition to Concord school at 5900 Concord Ave. Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. The CITY ofEDINAStaff Recommendation EdinaMN.gov 15 Approval is subject to the following conditions: 1. The site must be developed and maintained in conformance with the following plans: • Site plan date stamped, May 22, 2022. • Grading and drainage plan date stamped, May 22, 2022. • Landscaping plan date stamped, May 22, 2022. • Geometric plan date stamped, May 22, 2022. • Utility and erosion control plan date stamped, May 22, 2022. 2. A building and grading permit is required for the improvements. Compliance with the engineer’s memorandum dated June 13, 2022. 3. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. Survey Responses 30 January 2019 - 25 July 2022 Public Hearing Comments-Concord Better Together Edina Project: Public Hearing: 5900 Concord Ave., Concord Elementary CUP No Responses VISITORS 4 CONTRIBUTORS 0 RESPONSES 0 0 Registered 0 Unverified 0 Anonymous 0 Registered 0 Unverified 0 Anonymous Date: August 3, 2022 Agenda Item #: VIII.H. To:Mayor and City Council Item Type: Report / Recommendation From:Cary Teague, Community Development Director Item Activity: Subject:Resolution No. 2022-61: Conditional Use Permit for Countryside Elementary School, 5701 Benton Ave. Action CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: Adopt Resolution No. 2022-61 approving the conditional use permit. INTRODUCTION: Edina P ublic Schools requested a Conditional Use Permit for building additions and an expanded parking lot at Countryside Elementary School located at 5701 Benton Avenue. The goal of the expanded parking lot is to make the site safer by separating parent and bussing drop off areas. ATTACHMENTS: Description Resolution No. 2022-61 Planning Commission Staff Report Engineering Review Memo Applicant Narrative Site Location and Zoning Proposed Plan Renderings Proposed Plans Minor Site Plan & building elevation revisions Traffic Impact Study Staff Presentation Better Together Report Staff Presentation 1 RESOLUTION NO. 2022-61 APPROVING A CONDITIONAL USE PERMIT FOR COUNTRYSIDE SCHOOL AT 5701 BENTON AVENUE BE IT RESOLVED by the City Council of the City of Edina, Minnesota, as follows: Section 1. BACKGROUND. 1.01 The Edina Public Schools are proposing to build classroom additions and expand their parking lot and reconfigure the bus pick-up and drop-off area at Countryside School located at 5701 Benton Avenue. The purpose of the request is to add nine teaching spaces, an additional multipurpose room and parking lot expansion to separate bus and student drop off traffic for improved on-site safety. 1.02 The building additions at Countryside include the addition of six (6) classrooms, two (2) kindergarten rooms, one (1) Special Services room, a reconstruction of the middle link/ramp to meet ADA requirements, and a multipurpose room; all of which will allow the building to house the new Spanish immersion program starting offsite in the fall of 2022 and moving to Countryside Elementary once construction is completed. The building expansions and reconfigured parking areas conform to the conditional use permit requirements within the R- 1 zoning district. 1.03 The number of parking spaces would increase from 94 parking stalls and 12 bus stalls, (106 stalls total), to 110 parking stalls and 16 bus stalls, (126 total), by expanding and restriping the lot on the east side of the building. The bus pick-up and drop-off area would be reconfigured on the east side of the building and a new access to the site would be added off Tracy Avenue. Buses would now enter and exit the site off Tracy Avenue rather than Benton Avenue. The parent drop off would now occur in the north parking lot. The new Tracy driveway would only be for buses and staff. 1.04 A Conditional Use Permit is required for the expanded parking area and boundaries of the Country Club. Golf Courses are a permitted use in the R-1, Single-Dwelling Unit District. 1.05 The property is legally described as follows: See attached legal descriptions. 1.06 To accommodate the request, the following land use applications are requested: 1. A Conditional Use Permit. 1.07 On June 29, 2022, the Planning Commission recommended approval of the request. Vote: 4 ayes, 1 nay. A condition was added that the School District consider adding EV charging stations that is reasonable for the site. 1.08 On July 19, 2022, the City Council held a public hearing on the Conditional Use Permit. RESOLUTION NO. 2022-61 Page 2 Section 2. FINDINGS 2.01 Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. Section 3. APPROVAL NOW THEREFORE, it is hereby resolved by the City Council of the City of Edina, approves the Conditional Use Permit for Countryside School for Edina Public Schools. Approval is subject to the following conditions: 3.01 Subject to staff approval, the site must be developed and maintained in substantial conformance with the following plans, unless modified by the conditions below: 1. The site must be developed and maintained in conformance with the following plans: Site plan date stamped May 22, 2022. Plan modifications dated May 27, 2022. Lighting photometric May 22, 2022. Grading and drainage plan date stamped May 22, 2022. Landscaping plan date stamped May 22, 2022 Geometric plan date stamped May 22, 2022 Utility and erosion control plan date stamped May 22, 2022. 2. A building and grading permit is required for the improvements. 3. A lighting plan, landscape plan and grading plan must be submitted, and meet all minimum zoning ordinance requirements. 4. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. 5. Additional evergreens along Benton and Tracy must be planted to fill in the gaps of existing and proposed landscaping to provide better screening of the parking lots for residents across the street from the school. Final Landscape Plan and additional screening is subject to review and approval of the city forester prior to issuance of a building permit. 6. The School District shall consider adding EV charging stations within the parking lot. RESOLUTION NO. 2022-61 Page 3 Adopted by the City Council of the City of Edina, Minnesota, on August 3, 2022. ATTEST: Sharon Allison, City Clerk James B. Hovland, Mayor STATE OF MINNESOTA ) COUNTY OF HENNEPIN )SS CITY OF EDINA ) CERTIFICATE OF CITY CLERK I, the undersigned duly appointed and acting City Clerk for the City of Edina do hereby certify that the attached and foregoing Resolution was duly adopted by the Edina City Council at its Regular Meeting of August 3, 2023, and as recorded in the Minutes of said Regular Meeting. WITNESS my hand and seal of said City this ____ day of __________________, 2022. _________________________________ City Clerk June 29, 2022 Planning Commission Cary Teague, Community Development Director Conditional Use Permit – 5701 Benton Avenue (Countryside School) Information / Background: The Edina Public Schools are proposing classroom building additions, expanding their parking lot and reconfigure the bus pick-up and drop-off area at Countryside School located at 5701 Benton Avenue. The purpose of the request is to add nine teaching spaces, an additional multipurpose room and parking lot expansion to separate bus and student drop off traffic for improved on-site safety. The building additions at Countryside include the addition of six (6) classrooms, two (2) kindergarten rooms, one (1) Special Services room, a reconstruction of the middle link/ramp to meet ADA requirements, and a multipurpose room; all of which will allow the building to house the new Spanish immersion program starting offsite in the fall of 2022 and moving to Countryside Elementary once construction is completed. The building expansions and reconfigured parking areas conform to the conditional use permit requirements within the R-1 zoning district. The number of parking spaces would increase from 94 parking stalls and 12 bus stalls, (106 stalls total), to 110 parking stalls and 16 bus stalls, (126 total), by expanding and restriping the lot on the east side of the building. The bus pick-up and drop-off area would be reconfigured on the east side of the building and a new access to the site would be added off Tracy Avenue. (See attached plans.) Buses would now enter and exit the site off Tracy Avenue rather than Benton Avenue. The parent drop off would now occur in the north parking lot. The new Tracy driveway would only be for buses and staff. The request requires a conditional use permit for building expansion and the expansion of parking spaces on the east side of the building. STAFF REPORT Page 2 SUPPORTING INFORMATION Surrounding Land Uses Northerly: Single-family homes; zoned and guided low-density residential. Easterly: Single-family homes; zoned and guided low-density residential. Southerly: Single-family homes; zoned and guided low-density residential. Westerly: Single-family homes; zoned and guided low-density residential. Existing Site Features The existing 14.6-acre site contains the school, parking areas, play fields a wetland and a scattering of mature trees. Planning Guide Plan designation: Public/semi-public Zoning: R-1, Single Dwelling Unit District Conditional Use Permit Per Section 36-305, the City Council shall not grant a Conditional Use Permit unless it finds that the establishment, maintenance, and operation of the use: 1. Does not have an undue adverse impact on governmental facilities, utilities, services or existing or proposed improvements. The project would not have an adverse impact on the above. Both police and fire would be able to access the site off Benton as they do today, and now off Tracy with the new access point. There would be no change to utilities by the project. The existing utilities are adequate to serve the proposed use. 2. Will generate traffic within the capacity of the streets serving the property. According to the independent traffic study done by Bolton and Menk, the project would not have a significant impact on surrounding neighborhood traffic. The study confirmed a recommended access drive from Tracy Ave. with a stop sign existing the new drive lane onto Tracy Ave. The new driveway from Tracy would only be for buses and staff. Parent drop-offs would continue off Benton Avenue. The south exit onto Tracy Avenue will be a two-way exit. Staff and buses will be able to enter and exit from Tracy Ave. The application would not require larger infrastructure improvements related to the streets around the school. Engineering staff has reviewed the turn movements on Tracy Avenue and feel there would be adequate sight lines. Staff believes the timing of student crossings compared to staff entering and exiting the site will be different and thus not create additional issues for crossing of Tracy. Staff feels there STAFF REPORT Page 3 is adequate sight lines of the crosswalk today. The project would not change those sightlines. The school may also consider crossing guards to assist with crossings. 3. Does not have an undue adverse impact on the public health, safety, or welfare. Staff does not believe the project would have an adverse impact on public health, safety, or welfare. The separation of buses and parent drop off should improve on-site safety. Engineering staff does not believe any roadway improvements would be necessary. 4. Will not impede the normal and orderly development and improvement of other property in the vicinity. The proposed improvements would not impede development in the area. 5. Conforms to the applicable restrictions and special conditions of the district in which it is located as imposed by this Section. The proposed project meets all city code provisions. Schools and expansion parking lots are conditionally permitted uses within the R-1 Zoning District. 6. Is consistent with the Comprehensive Plan. As mentioned previously, building and parking lot expansions are a conditionally permitted use within the R-1 zoning district. The proposed use is consistent with the Comprehensive Plan. Landscaping New landscaping is proposed along Tracy Avenue to help screen the expanded parking area. (See attached landscape plan) Additionally, there is an accessory building that would be relocated as part of the parking expansion. Holmstrup Arborvitae would be planted around the building similar to those planted currently. Staff would recommend additional evergreen plantings along Benton and Tracy to fill in the gaps to provide better screening of the parking lots for residents across the street from the school. The city forester has reviewed the proposed landscape plan. A landscape plan would need to be submitted as part of the grading permit, subject to approval of the city forester. Grading/Drainage/Utilities The city engineer has reviewed the proposed plans and found them to be acceptable. Any approvals of this project would be subject to review and approval of the Minnehaha Creek Watershed Districts, as they are the City’s review authority over the grading of the site. Lighting The parking lots would be required to meet all minimum standards for lighting as follows: STAFF REPORT Page 4 “All exterior lighting and illuminating devices shall be provided with lenses, reflectors or shades so as to concentrate illumination on the property of the owner or operator of the lighting or illuminating devices. Rays of light or illumination shall not pass beyond the property lines of the premises utilizing the lights or illumination at an intensity greater than 0.5 footcandle measured at property lines abutting property zoned residential and one footcandle measured at property lines abutting streets or property zoned nonresidential. No light source, lamp or luminaire shall be directed beyond the boundaries of the lighted or illuminated premises.” A lighting plan has been submitted and demonstrates the foot candle power generated from the lights, would meet city code requirement. Compliance Table City Standard Proposed Front/parking – Benton Avenue Side Street/parking – Tracy Ave. Side Street/parking – Stuart Ave. Side – South/building Side – West/building Front – North/building Front – East/building 20 feet 20 feet 20 feet 50 feet 50 feet 50 feet 50 feet 20 feet (existing) 38 feet 20 feet (existing) 100+ feet (existing) 100+ feet (existing) 57 feet (existing) 140 feet Parking Stalls 78 126 PRIMARY ISSUES/STAFF RECOMMENDATION Primary Issue Is the Conditional Use Permit (CUP) criteria met? Yes, staff believes the criteria is met. 1. The proposal meets the Conditional Use Permit findings. As demonstrated on pages 2-3 of this report, the findings for a conditional use permit would be met. STAFF REPORT Page 5 2. The proposal meets all minimum Zoning Ordinance standards. All setback requirements and lighting standards would be met. 3. The proposal would improve traffic and circulation on the site. The number of parking stalls remains in compliance the Zoning Ordinance. The new driveway would only be for buses and staff. Parent drop-offs would continue off Benton Avenue. Staff and buses will be able to enter and exit from both Tracy Ave and Countryside Rd. Engineering staff has reviewed the left-hand turn movements on Tracy Avenue and feel there would be adequate sight lines. Staff believes the timing of student crossings compared to staff entering and exiting the site will be different and thus not create additional issues for crossing of Tracy. If the project is implemented, city staff can monitor the number of crossings of Tracy at the crosswalk to determine if pedestrian flashers are warranted to add extra notification of crossings. Staff believes there is adequate sight lines of the crosswalk today. The project would not change those sightlines. The school may also consider crossing guards to assist with crossings. 4. The plan includes landscaping and trees planted along Tracy Avenue and around the re- located maintenance building to provide partial screening. Staff does recommend additional plantings along Tracy and Benton to provide additional screening of the parking lot. Staff Recommendation Recommend that the City Council approve the Conditional Use Permit to expand the parking area for Countryside School at 5701 Benton Avenue. Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. Approval is subject to the following conditions: 1. The site must be developed and maintained in conformance with the following plans: Site plan date stamped May 22, 2022. Plan modifications dated May 27, 2022. Lighting photometric May 22, 2022. Grading and drainage plan date stamped May 22, 2022. Landscaping plan date stamped May 22, 2022 STAFF REPORT Page 6 Geometric plan date stamped May 22, 2022 Utility and erosion control plan date stamped May 22, 2022. 2. A building and grading permit is required for the improvements. 3. A lighting plan, landscape plan and grading plan must be submitted, and meet all minimum zoning ordinance requirements. 4. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. 5. Additional evergreens along Benton and Tracy must be planted to fill in the gaps of existing and proposed landscaping to provide better screening of the parking lots for residents across the street from the school. Final Landscape Plan and additional screening is subject to review and approval of the city forester prior to issuance of a building permit. Deadline for a city decision: July 30 , 2022 DATE: 6/13/2022 TO: 5701 Benton Ave, Countryside Elementary, Development Team CC: Cary Teague – Community Development Director FROM: Mattias Oddsson, Engineering Intern Zuleyka Marquez, PE, Graduate Engineer RE: 5701 Benton Ave – Conditional Use Permit Review The Engineering Department has reviewed the subject property for pedestrian facilities, utility connections, grading, flood risk, and storm water. Plans reviewed included civil, landscape, and survey drawings stamped 5/27/2022. Review Comment Required For General 1. Deliver as-built records of public and private utility infrastructure post construction. Certificate of Occupancy 2. Maintenance of sidewalks to be responsibility of property owner. General Comment Survey 3. An existing and proposed site condition survey is required. Grading/Building Permit 3.1 Show all existing and proposed public and private easements. Grading/Building Permit Living Streets 4. Design sidewalks to meet ADA requirements. Grading/Building Permit 5. Pedestrian crosswalk required at new driveway apron at Tracy Ave and Countryside Rd. If damaged during construction, applicant required to install new thermoplastic crosswalk blocks per Cit standard. Traffic and Street 6. Review fire access requirements with fire department. Fire truck turning template attached. Grading/Building Permit 7. A new driveway entrance is proposed along Tracy Ave, near Countryside Rd. Apply for a Public Works commercial curb cut permit. Grading/Building Permit 8. Tracy Avenue was reconstructed in 2016, and Benton Avenue was reconstructed in 2015. Avoid any damage. Damage to be repaired per standard plates 540 and 542. Certificate of Occupancy 9. Coordinate with Engineering Department if changes to on-street parking restrictions along Tracy Avenue are anticipated. Certificate of Occupancy Sanitary and Water Utilities 10. Verify fire demand and hydrant locations. Grading/Building Permit 11. Domestic water shall be sized by the developer’s engineer. Grading/Building Permit 12. Domestic sanitary shall be sized by the developer’s engineer. Grading/Building Permit 13. Apply for a sewer & water connection permit with Public Works. Prior to Starting Utility Work 13.1 Meter required for building service line and combined lines. No meter required for fire only service line. Grading/Building Permit 13.2 Public Works to determine acceptable installation methods. Grading/Building Permit 14. Disconnected sanitary and water services to be capped at main. 15. A SAC determination will be required by the Metropolitan Council. The SAC determination will be used by the City to calculate sewer and water connection charges. Grading/Building Permit 16. Single connection from main for fire and domestic, split after main connection. Grading/Building Permit 17. Wells not likely onsite. Notify City and MDH if well is located onsite during the course of the work. Certificate of Occupancy Storm Water Utility 18. Provide final geotechnical report with soil borings. Grading/Building Permit 19. Local 1% annual chance floodplain with an elevation of 911.8’ located in north parking. Avoid fill. Provide net cut/fill calculations below 911.8’. Grading/Building Permit 20. Provide the proposed lowest opening elevations for the new structures. Required at no less than 913.8’. Grading/Building Permit 21. Add rip rap at outlet for new dry basin or extend to pond to avoid erosion. 22. Provide hydraulic and hydrologic report meeting watershed and state construction site permit requirements. Grading/Building Permit 23. Submit watershed district permit and copies of private maintenance agreement in favor of watershed. Grading/Building Permit Grading Erosion and Sediment Control 24. A SWPPP consistent with the State General Construction Site Stormwater Permit is required. Grading/Building Permit Constructability and Safety 25. Construction staging, traffic control, and pedestrian access plans will be required. Grading/Building Permit Other Agency Coordination 26. MDH, MPCA and MCES permits required as needed. Grading/Building Permit 27. Coordinate relocation of utility pole and fiber as needed for playground and curb cut construction. 28. Minnehaha Creek Watershed District permit is required. Grading/Building Permit Sustainability 29. Consider installation of electric vehicle chargers for a minimum of 5% of additional proposed parking and wiring an additional 10% for EV conversion in the future. General Comment 30. See Sustainable Design Questionnaire for additional considerations, including: • Utilize Xcel Energy’s Energy Design Assistance or Energy Efficient Buildings, and/or CenterPoint Energy’s Builder and Developer programs for this development to optimize building performance. • Install appliances and equipment that are Energy Star or EPA WaterSense certified. • Consider rooftop solar. Use UMN’s Solar Suitability map to assess solar opportunity, and the National Renewable Energy Lab’s calculator to assess solar production. General Comment Edina, Hennepin, MetroGIS | © WSB & Associates 2013, © WSB & Associates2013 Countryside School - 5701 Benton June 23, 2022 1 in = 752 ft / Edina, Hennepin, MetroGIS, Edina, Hennepin, MetroGIS | © WSB & Associates2013, Hennepin County, Edina, © WSB & Associates 2013 Countryside School - 5701 Benton June 23, 2022 1 in = 376 ft / Edina, Hennepin, MetroGIS, Edina, Hennepin, MetroGIS | © WSB & Associates2013, Hennepin County, Edina, © WSB & Associates 2013 Countryside School - 5701 Benton June 23, 2022 1 in = 188 ft / Edina, Hennepin, MetroGIS | © WSB & Associates 2013, © WSB & Associates2013 Zoning Map Legend June 23, 2022 1 in = 752 ft / L _ I BENTON AVE • • \\\\/ R \\\\\\ • •• BENTON AVE LEGEND: MAIN ENTRANCE 4%. • • ,!!:.,! 3AV idf108EIV PEDESTRIANS PEDESTRIANS BUS ROUTE PARENT DROP OFF/ PICK UP TRAFFIC NEW CLASSROOM ADDITIONS HOW THE PLAN ADDRESSES THE ISSUES: STUDENTS DROPPED OFF BY PARENTS WILL NOW HAVE DIRECT ACCESS TO AN ADJACENT SIDEWALK THE PARENT PICK UP/DROP OFF LOOP AND THE BUS PICK UP/DROP OFF LOOP ARE NOW ENTIRELY SEPERATED, ALLOWING TRAFFIC ON THE SITE TO FLOW, AND PEDESTRIANS AT THE CROSSWALK A SAFE CROSSING 0 SCHOOL BUSES AND PARENTS WILL NOW HAVE SEPERATE ACCESS TO THE SITE 0 PARENTS WILL STILL DROP OFF AND PICK UP THEIR STUDENTS ON THE NORTH END OF THE SCHOOL, BUT THEY WILL NOW HAVE DIRECT ACCESS TO THE SIDEWALK. THIS REMOVES STUDENT DROP OFF FROM BENTON AVE. AND BRINGS STUDENTS AND PARENTS DIRECTLY TO THE SCHOOLS FRONT ENTRY STUDENTS RIDING THE BUS WILL STILL BE DROPPED OFF AND PICKED UP WITH DIRECT ACCESS TO THE SIDEWALK REMOVED STAIR ELIMINATES A ROUTE THAT STUDENTS AND PARENTS WOULD USE AS ANOTHER DROP OFF AND PEDESTRIANS ROUTE, FURTHER SIMPLIFFYING TRAFFIC FLOW 0 NEW STOP SIGN, RIGHT AND LEFT TURN EXIT LANES BUS ENTRANCE NEW HARDPLAY AND PLAYGROUND EXTENTS PLANNING pFeN CITY OF MAY (;.'; 1 COUNTRYSIDE RD !,‘ ' - -7 3 • BENTON AVE ............................ - • .............. .... 1:011"47 741 iT-C3li [Ai:1446 Fr BENTON AVE LEGEND: PEDESTRIANS BUS ROUTE > PARENT DROP OFF/ PICK UP TRAFFIC NEW CLASSROOM ADDITIONS CURRENT SITE CONDITIONS: STUDENTS GETTING DROPPED OFF CROSS THE BUS DROP OFF LOOP AND BUS TRAFFIC BUS EXIT, PARENT PICK UP/DROP OFF, AND PEDESTRIAN CROSSING LOOPS OVERLAP, CAUSING DELAYS, BACKUPS, AND AN UN-SAFE PEDESTRIAN CROSSWALK BUSES AND PARENTS CURRENTLY USE THE SAME ROADD TO ENTER AND EXIT THE SCHOOL'S PARKING LOTS, CREATING DISORGANIZED TRAFFIC FLOW AND BACKUPS ONTO SURROUNDING NEIGHBORHOOD STREETS c,ITY OF EDINA PARENTS DROP STUDENTS OFF ACROSS THE STREET FROM THE SCHOOL, PEDESTRIANS HAVE TO CROSS CAR TRAFFIC MAY 97 2022 COUNTRYSIDE RD PARENTS DROP STUDENTS OFF IN A PARKING LOT, WITHOUT DIRECT ACCESS TO A SIDEWALK PLANNING DEPARTMEN1 COPING TO MATCH EXISTING GLAZING BRICK TO MATCH EXISTING 1 1 „ 111 1 1 =111 11 —1 II III II I-1 I 1— I I I —1 I I—I I 1 LINK SOUTH ELEVATION 1/16" = l'-O" 0 12' 24' I -Tr--Iminiffiffi=1Ln —I I I—I I I.-1 I I-1 I I—I I I SPED EAST ELEVATION 1/16" = 0 12' 24' ISD #273 2023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONS May 27, 2022 COPING TO MATCH EXISTING STUCCO OVERHANG LOUVERS BRICK TO MATCH EXISTING GLAZING STUCCO 1 —1 I I-111 III III III III III III III III 1 1 1-1 1 I—I I CLASSROOM SOUTH ELEVATION 1/16" = 0 12' 24' 5 KEY PLAN EXISTING ELEVATION CONTINUES EXISTING I NEW PRECAST SILLS GLAZING STUCCO TO COPING TO MATCH EXISTING LOUVERS LOUVERS ] MATCH EXISTING LOUVERS STUCCO OVERHANG PRECAST COLUMN CAP BRICK TO MATCH EXISTING BRICK FINS TO MATCH EXISTING 1r -i i-111 I Ili II 111 III 111 111 III III III III —111-111-1 1 I-111-111 II I—I 1 1-1 1 I—I I 1-1 I I11 I-1 1 I—I 1 1-1 1 1-1 1 I-1 I 1-1 1 I—I I I—I 1 1-1 1 1 CLASSROOM WEST ELEVATION 1/16" = 1'-0" 0 12' 24' PRECAST SILLS 1 11 I II I 1 111 11 111- 111 111 III III II I—I I COPING TO MATCH EXISTING GLAZING BRICK TO MATCH EXISTING LOUVERS BRICK PLANTER LINK NORTH ELEVATION 1/16" = 1,-0" 0 12' 24' 2 COPING TO MATCH EXISTING CITY OF EDINA PLANNING DEPARTMENT GLAZING PRECAST SILLS 7 BRICK TO MATCH EXISTING 7 EXISTING ELEVATION CONTINUES NEW I EXISTING PRECAST SILLS EXISTING ELEVATION CONTINUES EXISTING I NEW NEW I EXISTING COPING TO MATCH EXISTING BRICK TO MATCH COPING TO MATCH EXISTING EXISTING 1/16" = 1,-0" 0 12' 24' BRICK TO MATCH EXISTING 111--111-=1:11_=111=-111E1111-_-111-111_111_111_111 I 111 III III MULTI-PURPOSE WEST ELEVATION 7 MULTI-PURPOSE SOUTH ELEVATION 1/16" = 1,-0" 0 12' 24' I-11 1_1 1 1 1 1 I-11 1_1 1 1 I 1 1 1 1_1 1 1 1 I I= 5/26/2022 3:55:53 PM BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Centralist BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _2021 Centralist COUNTRYSIDE NEW BUILDING ELEVATIONS CUP CS A2.1 Comm No: 222005/222026 1=ErulhAIMM5..!1 a, EMO ETGr- oocnocnom„,„ orm 00 V 0,00000oc47 vr,00.1.o% MAIN ENTRY OFFCE cuSSROOm CLASSROOM 11 E CLASSROOM O IMSEROARTEN 0 30' 60' (.') ,3 MAIN LEVEL FLOOR PLAN 1" = 40'-0" 0 30' 60' CUSSRCOm -> .1,11Rom UMP STORXECH E EV 570INAECM 0 • • KNOERCARTEN 'LOCKE STOR s s , VS>, •-k • 0 _L • • • f""" STOR CUSTOOML J II ¶Pt ¢a Fad CAFETERM KmDERCARTEN VAV E KITCHEN CALM ROO VAV 4 CITY OF EDINA PLANNING DEPARTMENT Yk, dfiAr6"4 ISD #273 2023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONS May 27, 2022 UPPER LEVEL FLOOR PLAN 1" = 40'-0" 5/26/2022 3:55:50 PM BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.M BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _2021 Central.M COUNTRYSIDE UPPER & LOWER FLOOR PLANS CUP CS A1.1 Comm No: 222005/222026 5 FT CHAIN LINKFENCE5 FT CHAIN LINKFENCEC O N C R E T E C O N C R E T E C O N C R E T E B I T U M I N O U SB I T U M I N O U S BRICK WALLWOOD TIMBERWALLG R A S SG R A S SG R A S SG R A S SG R A S SPLAYGROUNDEQUIPMENTPROPERTY LINEPROPERTY LINEPROPERTY LINESOUTH LINE OF THE NW 1/4 OFTHE SE 1/4 OF SEC. 32 T.117 R.21ROADWAY & UTILITY EASEMENT PER DOC. NO. 3211764 10105 5 UTILITY EASEMENT PERBROADMORE ADDITIONCONCRETEMETAL RAILB I T U M I N O U SB I T U M I N O U SB I T U M I N O U SB I T U M I N O U SCONCRETECONCRETECONCRETECONCRETECONCRETE CONCRETECONCRETECONCRETECONCRETECONCRETE CONCRETE CONCRETEPTBL6 FT . WOODFENCENORTH PARKING51 PROPOSED STALLS(3 ACCESSIBLE, 48 REGULAR)EAST PARKINGNEW BIKE RACK (MATCHEXISTING) AND CONCRETE SLABREPLACE SECTIONOF DRIVE -CONFIRM EXACTAREA ONSITE WITHOWNER/ENGINEERCRACK SEAL AND SEAL COAT.STAY OUTSIDE OAK TREEROOT ZONES / DRIPLINESDRY STORMWATER BASINB6-12 CURB'DO NOT ENTER' OR'EXIT ONLY' SIGNPLAYGROUNDBUILDING ADDITION 2REFER TO ARCHITECTURAL PLANSFOR DIMENSIONS AND LAYOUTEAST PARKING66 EXISTING STALLS59 PROPOSED STALLS(3 ACCESSIBLE, 56 REGULAR)16 BUS STALLSBUILDINGADDITION 3REFER TOARCHITECTURAL PLANSFOR DIMENSIONS ANDLAYOUTBUILDINGADDITION 4REFER TOARCHITECTURALPLANS FORDIMENSIONS ANDLAYOUTBUILDING ADDITION 1REFER TO ARCHITECTURAL PLANSFOR DIMENSIONS AND LAYOUTRELOCATEDSHEDD4-12 CURBPLAYGROUNDEQUIPMENT ANDSURFACING BY OTHERSHARD PLAYSTOP SIGN'DO NOT ENTER' SIGNS10 987 654 321 10 987 654 321 FOUR BIG BLOCK WALLS NOTALLER THAN 18" WITHCONCRETE WALK INFILL.EXACT END OF BIG BLOCK SEAT WALLTO BE DETERMINED. STOP FENCE ATCONCRETE WALK START.INFILL AREA WITH GRO-LOWFRAGRANT SUMAC TO STABILIZE ANDDETER CUT-THROUGH. CAN TAKESNOW PACK AND SOME WALKING.CONCRETE PAD FOR SHEDGAGA PIT8.008.006.008.004' CHAIN LINK FENCE4' CHAIN LINK FENCECHAIN LINK FENCE WHERENEEDED TO MEET CODEAPPROXIMATE LOCATIONOF NEW STAIRSMULTIPLE TIERS OF BIG BLOCKWALLS TO KEEP EACH WALLBELOW 30" HEIGHTDateRegistration NumberCheck:Drawn:Date:Comm:I hereby certify that this plan, specification or report was prepared byme or under my direct supervision and that I am a duly Licensedunder the laws of the State ofHGFEDCBA12345678109CMNRevisionsDescriptionDateNumScale:NorthCOUNTRYSIDE5701 NORMANDALE ROADXXXXXXDISTRICT #2735701 BENTON AVENUE SOUTHEDINA, MN 55436INDEPENDENT SCHOOLAND CONCORDELEMENTARYEDINA, MN 5542405-27-2022LJDDAR1"=30'PROFESSIONAL ENGINEER05/27/2022DAVID A. REY40180MINNESOTASCHOOLS ADDITIONS7575 GOLDEN VALLEY ROAD, SUITE 200GOLDEN VALLEY, MINNESOTA 55427Phone: (763) 544-7129Email: goldenvalley@bolton-menk.comwww.bolton-menk.comCITY SUBMITTALNOT FOR CONSTRUCTIONNOTES:1.REFER TO SHEET C1.31, COUNTRYSIDE GRADING AND DRAINAGE PLAN, FOR GENERAL NOTES.2. CHECK ALL PLAN AND DETAIL DIMENSIONS AND VERIFY SAME BEFORE FIELD LAYOUT.3.SIGNAGE SHALL GENERALLY BE INSTALLED 18" BEHIND THE BACK OF CURB.4.ALL DISTURBED AREAS OUTSIDE THE BUILDING PAD WHICH ARE NOT DESIGNATED TO BEPAVED SHALL RECEIVE AT LEAST 6" OF TOPSOIL AND SHALL BE SODDED OR SEEDED.5.WHERE NEW SOD MEETS EXISTING TURF, EXISTING TURF EDGE SHALL BE CUT TO ALLOW FORA CONSISTENT, UNIFORM STRAIGHT EDGE. JAGGED OR UNEVEN EDGES WILL NOT BEACCEPTABLE. REMOVE TOPSOIL AT JOINT BETWEEN EXISTING AND NEW AS REQUIRED TOALLOW NEW SOD SURFACE TO BE FLUSH WITH EXISTING.6. FAILURE OF TURF DEVELOPMENT: IN THE EVENT THE CONTRACTOR FAILS TO PROVIDE ANACCEPTABLE TURF, THE CONTRACTOR SHALL RE-SOD OR RE-SEED ALL APPLICABLE AREAS,AT NO ADDITIONAL COST TO THE OWNER, TO THE SATISFACTION OF THE ENGINEER.EXISTING PARKING COUNTS (94 TOTAL STALLS):CAR PARKING = 94 STALLSBUS PARKING = 12 STALLSPROPOSED PARKING COUNTS (110 TOTAL CAR STALLS):CAR PARKING = 110 STALLSBUS PARKING = 16 BUS STALLSACCESSIBLE PARKING STALL REQUIREMENTS = 6 STALLSACCESSIBLE PARKING STALLS PROVIDED = 6 STALLSSITE STATISTICS:LEGENDREFERENCE KEY TO SITE DETAILS DETAIL I.D NUMBER (TOP) DETAIL SHEET NUMBER (BOTTOM)PROPOSED CONCRETE WALKPROPOSED CONCRETE SLABPROPOSED BITUMINOUS PAVEMENT CRACKSEAL / SEALCOATPROPOSED MEDIUM DUTY BITUMINOUS PAVEMENTPROPOSED HEAVY DUTY BITUMINOUS PAVEMENTPROPOSED STREET BITUMINOUS PAVEMENTPROPOSED TRAFFIC CONTROL SIGNPAINTED ACCESSIBLE SYMBOLPROPOSED MANHOLE (MH)PROPOSED CATCH BASIN (CB)PROPOSED SURGE BASIN (SB)PROPOSED LIGHT POLE - REFER TO ELECTRICAL PLANSPROPERTY LINE1C2.11C1.21COUNTRYSIDEFINISHING PLAN01530ADDITIONAL MASONRY WALLS TOACCOUNT FOR GRADE DIFFERENCE, ANDALSO ALLOW FOR STUDENT SEATINGPLAY AREA ISTHE SAME,JUST MOREDEFINEDHARD SURFACEAROUND THE BUILDINGADDITION IS REMOVEDEXISTING STAIR ISREMOVED ANDREPLACEDEXISTING AMPETHEATER STAIRIS REMOVED AND REPLACEDWITH NEW, MASONRY WALLS TOMAKE UP GRADE DIFFERENCEPRODUCT DATA CAN BEPROVIDED IF NEEDEDSMALL PORTION OFADDED FENCING TOENCOURAGE STUDENTSTO STAY OUT OFSTORMWATER BASIN. CHAIN LINK FENCE ISUSED THROUGHOUTTHE DISTRICTEXISTING, SMALLSHED, IS TO BERELOCATED FROMAROUND THE CORNERHARD PLAY AREA ISSIMILAR, JUST MOREDEFINED AND DETAILEDCONCRETE WALKDESIGN IS SIMILAR TOORIGINAL, JUSTSHIFTED EASTNO CHANGE TO:- PARKING LOTS- PARKING COUNTS- CURB CUTS- LIGHTING- MINIMAL CHANGES TOGRADING ONLY IN RELATION TOTHE PLAYGROUND ORIGINAL SUBMITTAL SHEET UPDN??CLASSROOM CLASSROOMCLASSROOMTOILETWASHGIRLSCUSTODIALSTAIR CLASSROOMCLASSROOMSTAFF LOUNGECLASSROOMCLASSROOM CLASSROOMCLASSROOMCONFCONFEXTENDED LEARNINGTECH STORCONFCONFCLASSROOM CLASSROOMCLASSROOMCLASSROOMCLASSROOMCLASSROOMWASHYLTLTTLTCUSTTLTWASHSTOR/MECHSTOR/MECHMECHSUMPELEVCLASSROOMCUSTODIALCLASSROOMWASHBOYSCLASSROOM CLASSROOMSPECIALISTCONFCONF MEDIA CENTERLEARNING COMMONSCONFCONFCONFCLASSROOM CLASSROOM CLASSROOM CLASSROOM CLASSROOMMUSICKILN/STORARTBOYSWASHELCUSTTLTWASHGIRLSELEVATORTLTTLTKINDERGARTENKINDERGARTENTLT STORAGEFLEXCLASSROOMCLASSROOMMULTIPURPOSE ROOMSTORAGETLTKINDERGARTEN LOCKERSSTORYSGTELECTLTSTAFF LOUNGEBAND STORBANDGYMSTORSTORLOCKERSKINDERGARTENKINDERGARTEN LOCKERSKIDS CLUBSTORSPEDCALM ROOMOFFICETLTSM. GROUP SM. GROUP SM. GROUPCLASSROOMTLTCUSTODIAL TLTSTORCAFETERIAKITCHEN STORMOTORCB FBDRESOURCESTORSPEECHLDSTORMAIN OFFICEOFFICEOFFICEOFFICECONFNURSETLTNURSEOFFICECUSTODIALWORK ROOMDHH/OTTLTSTORSTORSTORBOILERBIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvt5/26/2022 3:55:50 PMISD #2732023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONSMay 27, 2022Comm No: 222005/222026BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvtCOUNTRYSIDEUPPER & LOWERFLOOR PLANSCUP CS A1.101" = 40'-0"UPPER LEVEL FLOOR PLAN130' 60'01" = 40'-0"MAIN LEVEL FLOOR PLAN230' 60'EXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGEXISTINGEXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTINGNEW MAIN ENTRYEXISTING RAMP TO REMAINPORTION OF ADDITION WILLNOT BE CONSTRUCTED.EXISTING FACADE AT PLANWEST TO REMAIN BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvt5/26/2022 3:55:53 PMISD #2732023 COUNTRYSIDE & CONCORD ELEMENTARY ADDITIONSMay 27, 2022Comm No: 222005/222026BIM 360://2023 Countryside Elementary Addition/222005 Countryside Addition _ 2021 Central.rvtCOUNTRYSIDE NEWBUILDINGELEVATIONSCUP CS A2.101/16" = 1'-0"CLASSROOM SOUTH ELEVATION112' 24'01/16" = 1'-0"CLASSROOM WEST ELEVATION212' 24'01/16" = 1'-0"SPED EAST ELEVATION512' 24'01/16" = 1'-0"MULTI-PURPOSE SOUTH ELEVATION712' 24'01/16" = 1'-0"MULTI-PURPOSE WEST ELEVATION612' 24'01/16" = 1'-0"LINK NORTH ELEVATION312' 24'01/16" = 1'-0"LINK SOUTH ELEVATION412' 24'EXISTINGNEWEXISTINGNEWEXISTINGNEWEXISTING NEWKEY PLAN1234576COPING TO MATCH EXISTINGLOUVERSBRICK TO MATCHEXISTING STUCCO OVERHANGGLAZINGSTUCCOCOPING TO MATCH EXISTINGBRICK TO MATCHEXISTING STUCCO OVERHANGGLAZINGSTUCCO TO MATCH EXISTINGLOUVERSPRECAST SILLSLOUVERSEXISTING ELEVATIONCONTINUESBRICK FINS TO MATCH EXISTINGLOUVERSPRECAST COLUMN CAPBRICK TO MATCHEXISTING COPING TO MATCH EXISTINGGLAZING BRICK TO MATCHEXISTING COPING TO MATCH EXISTINGGLAZING PRECAST SILLSBRICK PLANTERLOUVERSEXISTING ELEVATIONCONTINUESBRICK TO MATCHEXISTING COPING TO MATCH EXISTINGGLAZING PRECAST SILLSEXISTING ELEVATIONCONTINUESBRICK TO MATCHEXISTING COPING TO MATCH EXISTINGGLAZING PRECAST SILLSBRICK TO MATCHEXISTING COPING TO MATCH EXISTINGTHIS ELEVATION IS NOLONGER NEW AND WILLREMAIN AS EXISTING BOLTON & MENK Real People. Real Solutions. Traffic Impact Study Countryside Elementary Parking and Drive Addition Edina, MN 5/26/2022 CITY OF EDINA MAY 2 7 2022 PLANNING DEPARTMENT Submitted by: Bolton & Menk, Inc. 12224 Nicollet Ave Burnsville, MN P: 952-890-0509 F: 952-890-8065 Certification Traffic Impact Study for Countryside Elementary Parking and Drive Addition Edina, MN BMI Project No. — OV1.124646 May 26, 2022 I hereby certify that this engineering document was prepared by me or under my direct personal supervision and that I am a duly licensed Professional Engineer under the laws of the State of Minnesota. Lim 5-26-22 Casey M Ke,Gcher Date License Number 58170 MY LICENSE RENEWAL DATE IS JUNE 1, 2022 Introduction The Edina Countryside Elementary School is in the process of planning a parking lot expansion, access drive addition and building expansion. The goal of the project is to improve traffic circulation in the school parking lots during school drop off and pickup hours as well as separate bus traffic and car rider traffic. A previous high level traffic review, Traffic Review of Edina Countryside Elementary Parking and Drive Addition Memo dated August 19, 2021, was completed. The purpose of this study is to further evaluate the need for a northbound left turn lane at the intersection of Tracy Avenue and Benton Avenue, determine impacts to the existing surrounding roadway network and identify potential mitigation solutions. Study Area The Edina Countryside Elementary School is located southwest of the Benton Avenue and Tracy Avenue intersection. This intersection and five other intersections within proximity to the school will be studied: • Tracy Avenue/Benton Avenue • Tracy Avenue/Existing Edina Countryside Elementary Entrance • Tracy Avenue/Countryside Road/New Parking Lot Entrance • Tracy Avenue/Grove Street (2 intersections) • Grove Street/Stuart Avenue The Edina Countryside Elementary School currently has an enrollment of approximately 600 students. 400 ride the bus and the remaining 200 are vehicle riders or pedestrians. The school hours are from 7:55 am to 2:25 pm. The school staff and volunteers total approximately 110 vehicles per day, which does not occur simultaneously with school peak hour traffic. Tracy Avenue is classified as a major collector with a 25 mile per hour speed limit and a 15 mile per hour school speed zone adjacent to the school property. It is a two-lane roadway with bike lanes and curb and gutter along both sides. As part of this traffic study, 24 hour Turning movement Counts for the study intersections were collected on March 29th, 2022. The AM Peak Hour and PM Peak Hours for the elementary school traffic were determined to be 7:15-8:15 am and 1:45-2:45 pm, respectively. See Appendix A for the traffic count information. I _ ,11.., , 1,_•-•1 " ----..-h-J r'i t , .— .4c'ectlse-Ea,guarncirt. ' __. . , . gen ili , ,, .24 0 ) FS, ( Ilt kJ .• --erl----,,,,,st 'lir 1 I ) n I 'r . 4 '''' SI -bilr"11 'W. - ' 41 ..re li."W'llr. ..4, ,141, 10 ta„, i4 ...Gr''... , S,:s, 0 1 ..k kip r k .4 , ' .. Yi mr _ I . -41 ' 4 , A. • ) ii••:_•44"'"irr ma ti----A-- al: 4 Ill Amill* 1 . r 4 WI.? i ' esc. - rAig!I -. Vi Amy.fcr —1 - atmii Or .. 'it ,I.,,mift•ciriktt 4 I ,I:Aim lip ...p-L1.--. .41.--7-...;•o ‘g .' 8 Tp" * ..° • LI • b Li 1. C 1 lf 1 A.A1 3g t I. 4?) ' .14 • 1,- 0, _ 11 . Z' 4 , .1: •4.4 ' r s - .1" 1 .,..." -F • eif4K.' 8 . • ,I• • Vi . I' •t••• • it . ^ri • • • ' t' J. - - 1 \ V.f I 7 • ^ 40- 4e.`2 - ja :;#4 14 am 601P•O'N. VtiC'cler° tf4 'P.,' • 04 "". -IA 41 doo617" Cantrysick Rd - co,Asido Fie — vs • irPOP--7 • L. 4 41 N4/ • b • J1 t o ss t .::;*4 • `1i!„ I 4i 0 Study Intersections Figure 1: Study Area Crash Analysis Five years of crash data, January 1, 2016, to December 31, 2021, was obtained from MNDOT to analyze historic crash data and identify existing safety deficiencies. The study area experienced 3 total crashes. All the crashes were property damage only. Only one crash occurred during the school drop off and pickup peak hours, and no crashes involved pedestrians. School Drop off and Pickup Students are dropped off and picked up at multiple locations inside and outside of the school parking lot. One crash occurred during school drop-off (7AM) and was located along Benton Avenue outside of the school parking lot. This property damage only crash occurred while one vehicle was stopped as student was being dropped off and another vehicle drove by and collided with the stopped vehicle's open door. Tracy Ave & Benton Ave Two crashes occurred at Tracy Avenue and Benton Avenue after school hours. Tracy Avenue and Benton Avenue is a four-way stop with the Eastbound and Westbound legs offset from each other. Both crashes involved two vehicles entering the intersection at the same time and were property damage only crashes. The observed total crash rate for this intersection for the five-year period is 0.49 per MEV which is 53% below the critical rate. See Appendix B for the Crash Analysis Green Sheet. Proposed Site Improvements Review Proposed improvements to the Edina Countryside Elementary School include expansion of the existing parking lot adjacent to Tracy Avenue, new full access driveway at the intersection of Tracy Avenue and Countryside Road and building additions to increase student capacity. Figure 2 below is the proposed site improvement plan dated 10-12-2021. Figure 2: Proposed Site Plan Forecasting Average daily traffic projections for 2043 conditions were developed using historic traffic growth. MNDOT historic traffic data revealed a 1% growth rate of traffic on Tracy Avenue south of Countryside Rd, 0.5% growth rate of traffic on Benton Avenue east of Tracy Avenue, and 0.5% growth rate of traffic on Tracy Avenue north of W Grove St. This compares to the Hennepin County Comprehensive Plan, which projects 1% population growth for Edina over the next 20 years. Building expansion to the Countryside Elementary School is estimated to add capacity of 199 students and 20 staff. Of the additional 199 students, 65% were assumed to take the bus and 35% were assumed to be dropped off and picked up via vehicle. This is according to the existing split of student transport that was provided by the school. With this assumption, 129 students take the bus which would be 4 additional buses, and 70 students would be car riders. Traffic Modeling The operational analysis results are described as a Level of Service (LOS) ranging from A to F. These letters serve to describe a range of operating conditions for different types of facilities. Levels of Service are calculated based on the Highway Capacity Manual 6th edition, which defines the level of service, based on control delay. Control delay is the delay experienced by vehicles slowing down as they are approaching the intersection, the wait time at the intersection, and the time for the vehicle to speed up through the intersection and enter the traffic stream. The average intersection control delay is a volume-weighted average of delay experienced by all motorists entering the intersection on all intersection approaches. The control delay is modeled within the analysis software, Traffic ware Synchro. Level of Service D or higher is commonly taken as acceptable design year LOS. The LOS and its associated intersection delay for a signalized and unsignalized intersection is presented below. The delay threshold for unsignalized intersections is lower for each LOS compared to signalized intersections, which accounts for the fact that people expect a higher quality of service when at a stop-controlled intersection. Table 1: Level of Service Criteria Signalized Intersection Unsignalized Intersection LOS Control Delay per Vehicle (sec.) Control Delay per Vehicle (sec.) A < 10 < 10 B >10 and 20 >10 and 15 C >20 and 35 >15 and 5_25 D >35 and ._. 55 >25 and 35 E >55 and 80 >35 and 50 F >80 >50 If v/c>1.0, LOS will be equal to F regardless of the delay value. Three Scenarios were analyzed to determine traffic impacts on the transportation system. The scenarios analyzed were: • Existing Conditions (2022) • Opening Day Build (2023) • Future Year Build (2043) Existing Conditions The existing conditions were analyzed using the existing roadway configuration and collected traffic count data to determine if there are existing traffic concerns. This analysis shows that all study intersections are operating at LOS A in both the AM and PM Peak hours (7:15-8:15 AM and 1:45-2:45 PM). The northbound movement at Tracy Avenue and Benton Avenue experiences a delay of 5 sec/vehicle in the AM peak hour and 4 sec/vehicle in the PM peak hour. Table 2 and Table 3 show the delay, level of service and queue for all the study intersections. Table 2: 2022 Existing Conditions AM Peak School Peak Traffic Delay (secheht Traffic Delay (secheh), Intersection Control Approach Movement (Delay - LOS) Approach (Delay - LOS) Intersection (Delay - LOS) Movement (Delay - LOS) Approach (Delay - LOS) Intersection (Delay - LOS) L T R L T R E Grove St & Tracy Ave Stop WB 6-A 5 - A 6-A 0-A 4 - A 3 - A 4 - A 0-A NB 0 - A 0 - A 0 - A 0-A 0 - A 0 - A SB 3 - A 0 - A - 1 - A 0 - A 0 - A Tracy Ave & W Grove St Stop EB 6-A 0 - A 3 - A 5 - A 2-A 6 - A 4 - A 5 - A 1 - A NB 4 - A 2 - A 3 - A 3 - A 1-A 2 - A SB 0 - A 0-A 0-A 0-A 0-A 0 - A Tracy Ave & Benton Ave Stop EB 9 - A 6 - A 7 - A 8-A 6-A 5 - A 2-A 3 - A 4 - A 4 - A WB 9 - A 9 - A 8-A 9-A 6 - A 6-A 3 - A 5 - A NB 5 - A 4 - A 4 - A 5 - A 4 - A 3 - A 3 - A 4 - A SB 7 - A 7 - A 4 - A 7 - A 5 - A 6-A 3 - A 6 - A Tracy Ave & Countryside Rd Stop WB 7 - A 3 - A 6-A 1 - A 6 - A 3 - A 5 - A 1 - A NB 0 - A 0 - A 0 - A 0-A 0-A 0 - A SB 4 - A 2 - A 3 - A 3 - A 1-A 2 - A Stuart Ave & W Grove St Stop EB 0 - A 0 - A 0-A 2-A 0 - A 0-A 0 - A 1 - A WB 3 - A 1-A 3 - A 2 - A 0-A 1 - A NB 4 - A 0 - A 3 - A 2 - A 4 - A 0-A 3 - A 3 - A School Entrance & Benton Ave Stop EB 1 - A 0-A 1-A 2 - A 0 - A 0 - A 0 - A 2 - A WB 3 - A 1-A 3 - A 2 - A 1-A 2 - A NB 4 - A 0 - A 3 - A 3 - A 3 - A 0 - A 2-A 2 - A Table 3: 2022 Existing Queuing AM Peak School Peak Traffic Queuing (feet) Traffic Queuing (feet) Intersection Control Approach Left Turn Through Right Turn Left Turn Through Right Turn Avg Max Avg Max Avg Max Avg Max Avg Max Avg Max E Grove St & Tracy Ave Stop WB 25 SO 25 50 25 50 25 50 NB SB 25 25 25 25 Tracy Ave & W Grove St Stop EB 25 SO 25 50 25 75 25 75 NB 25 75 25 75 25 50 25 50 SB 0 25 0 25 0 25 0 25 Tracy Ave & Benton Ave Stop EB 50 175 50 175 SO 175 50 100 50 100 50 100 WB 50 100 50 100 50 100 50 75 50 75 50 75 NB 50 100 50 100 50 100 50 100 50 100 50 100 SB 50 75 50 75 SO 75 50 75 50 75 50 75 Tracy Ave & Countryside Rd Stop WB 25 50 25 50 25 75 25 75 NB SB 25 50 25 50 25 25 25 25 Stuart Ave & W Grove St Stop EB 0 25 0 25 WB 25 75 25 75 0 25 0 25 NB 25 50 25 50 25 75 25 75 School Entrance & Benton Ave Stop EB WB 25 50 25 50 25 50 25 50 NB 50 100 50 100 50 75 50 75 Opening Day Build (2023) The Opening Day condition analyzed the proposed Countryside Elementary Parking and Drive Addition site layout (Figure 2) with the additional traffic generated from the expansion. The northbound movement at the Tracy Avenue and Benton Avenue intersection experiences a delay of 8 sec/vehicle in the AM peak hour and 6 sec/vehicle in the PM peak hour. Table 4 and Table 5 shows the delay, level of service and queue for all the study intersections. In the AM Peak hour, the northbound movement at Tracy Ave and Benton Ave experiences an average queue of 75ft which is about 3 cars, and a maximum queue of 175ft which is about 7 cars. In the PM Peak hour, the northbound movement at Tracy Ave and Benton Ave experiences an average queue of 50ft which is about 2 cars, and a maximum queue of 100ft which is about 4 cars. Table 4: 2023 Build Conditions AM Peak PM Peak Traffic Delay (sec/veh) Traffic Delay (sec/veh) Approach (Delay - LOS) Intersection (Delay - LOS) Intersection Control Approach Movement (Delay - LOS) Approach (Delay - LOS) Intersection (Delay - LOS) Movement (Delay -LOS) L T R L T R E Grove St & Tracy Ave Stop WB 7-A 4 - A 7 - A 0 - A 4 - A 4 - A 4-A 0 - A NB 0 - A 0-A 0 - A 0 - A 0-A 0 - A SB 3 - A 0 - A 1 - A 0 - A 0 - A Tracy Ave & W Grove St Stop EB 8 - A 0-A 4 - A 6-A 2 - A 6-A 0-A 3 - A 4 - A 1 - A NB 4 - A 2-A 3 - A 3 - A 1 - A 2 - A SB 0 - A 0 - A 0-A 0 - A 0 - A 0 - A Tracy Ave & Benton Ave Stop EB 9 - A 8 - A 8 - A 9-A 8-A 6-A 4 - A 4 - A 5 - A 5 - A WB 11-8 12-B 10-B 11 - B 6-A 7 - A 3 - A 6-A NB 8-A 7 - A 7 - A 8 - A 4-A 4 - A 4 - A 4-A SB 9 - A 8 - A 7 - A 8 - A 5 - A 6-A 3 - A 6-A Tracy Ave & SE Entrance/Countryside Rd Stop EB 9-A 4 - A 9 - A 2 - A 8 - A 3 - A 6-A 1 - A WB 7-A 4 - A 6 - A 7 - A 4 - A 6-A NB 2-A 1 - A 1 - A 2 - A 2 - A 0-A 0-A 1-A SB 4-A 2 - A 3 - A 3 - A 3 - A 1 - A 2-A 2 - A Stuart Ave & W Grove St Stop EB 0 - A 0 - A 0 - A 2 - A 0 - A 0 - A 0 - A 1 - A WB 3-A 0 - A 3 - A 2 - A 0 - A 2 - A NB 5 - A 0-A 3 - A 4 - A 5 - A 0 - A 3 - A 4 - A School Exit & Benton Ave Stop EB 1 - A 1 - A 3 - A 0 - A 0-A 3 - A WB 1-A 1 - A 1 - A 1 - A NB 8 - A 4 - A 7 - A 8-A 6-A 5 - A 5 - A 6-A Table 5: 2023 Build Queuing AM Peak PM Peak Traffic Queuing (feet) Traffic Queuing (feet) Intersection Control Approach Left Turn Through Right Turn Left Turn Through Right Turn Avg Max Avg Max Avg Max Avg Max Avg Max Avg Max E Grove St & Tracy Ave Stop WB 25 50 25 50 25 50 - 25 50 NB SB 0 25 0 25 Tracy Ave & W Grove St Stop EB 25 75 25 75 25 50 25 50 NB 25 75 25 75 25 50 25 50 SB Tracy Ave & Benton Ave Stop EB 50 150 50 150 50 150 50 100 50 100 50 100 WB 50 125 50 125 50 125 50 75 50 75 50 75 NB 75 175 75 175 75 175 50 1(X) 50 100 50 100 SB 75 150 75 150 75 150 50 75 50 75 50 75 Tracy Ave & SE Entrance/Countryside Rd Sto p EB 25 100 25 100 25 100 25 100 25 100 25 100 WB 25 50 25 50 25 50 25 75 25 75 25 75 NB 25 50 25 50 25 50 25 75 25 75 25 75 SB 25 50 25 50 25 50 25 50 25 50 25 50 Stuart Ave & W Grove St Stop EB 0 25 0 25 WB 25 50 25 50 25 50 25 50 NB 25 75 25 75 25 75 25 75 School Exit & Benton Ave Stop EB - WB NB 75 150 - - 75 150 50 125 50 125 Future Build (2043) The 2043 build condition analyzed the proposed Countryside Elementary Parking and Drive Addition site layout (Figure 2), additional traffic generated from the expansion, and the forecasted background traffic growth. The northbound movement experiences a delay of 7 sec/vehicle in the AM peak hour and 6 sec/vehicle in the PM peak hours. Table 6 and Table 7 shows the delay, level of service and queue for all the study intersections. In the AM Peak hour, the northbound movement at Tracy Ave and Benton Ave experiences an average queue of 75ft which is about 3 cars, and a maximum queue of I75ft which is about 7 cars. In the PM Peak hour, the northbound movement at Tracy Ave and Benton Ave experiences an average queue of 50ft which is about 2 cars, and a maximum queue of 100ft which is about 4 cars. Table 6: 2043 Build Conditions AM Peak PM Peak Traffic Delay (sec/veh) Traffic Delay (sec/veh) Intersection Control Approach Movement (Delay - LOS) Approach (Delay - LOS) Intersection (Delay - LOS) Movement (Delay - LOS) Approach (Delay - LOS) Intersection L T R L (Delay - LOS) T R E Grove St & Tracy Ave Stop WB 8 - A 4-A 8 - A 0-A 6 - A 5 - A 3 - A 0 - A NB 0- A 0 - A 0 - A 0 - A 0 - A SB 2-A 0 0 i A A 1 - A 0- A 0-A Tracy Ave & W Grove St Stop EB 7 - A 0 - A 4 - A 5 - A 2 - A 6 - A 0-A 3 - A 5-A NB 4 - A 2 - A 3 - A 3 - A 1 - A 1 - A 2-A SB 0 - A 0-A 0-A 0-A 0 - A 0 - A Tracy Ave & Benton Ave Stop EB 9-A 9 - A 8-A 9-A 8-A 6 - A 4 - A 4 - A S-A 5 - A WB 12-B 11-8 9-A 11 - B 6-A 7 - A 4 - A 6-A NB 8 - A 6 - A 7 - A 7 - A 5 - A 4 - A 4 - A 5 - A SB 8-A 7 - A 5 - A 7-A 6 - A 6-A 4 - A 6-A Tracy Ave & SE Entrance/Countryside Rd Stop WB 8 - A 4 - A 7-A 2-A 8 - A 3 - A 7-A 1 - A NB 1 - A 1-A 0-A 1 - A 1 - A 1 - A 1 - A 1 - A SB 5 - A 2 - A 3 - A 3 - A 5-A 1 - A 3 - A 2-A Stuart Ave & W Grove St Stop EB 0 - A 0-A 0-A 2 - A 0-A 0-A 0-A 1 - A WB 3 - A 1 - A 3 - A 2 - A 0 - A 1 - A NB 5 - A 0 - A 3 - A 4 - A 4 - A 3 - A 0-A 4 - A School Exit & Benton Ave Stop EB 1 - A 1-A 3-A 0-A 0-A WB 1 - A 1-A 1-A 3-A 1-A NB 7 - A 4-A 6 - A 7 - A 6-A 6 - A 1 - A 5 - A Table 7: 2043 Build Queuing AM Peak PM Peak Traffic Queuing (feet) Traffic Queuing (feet) Intersection Control Approach Left Turn Through Right Turn Left Turn Through Right Turn Avg Max Avg Max Avg Max Avg Max Avg Max Avg Max E Grove St & Tracy Ave Stop WB 25 50 25 50 25 50 25 50 NB SB 0 25 0 25 Tracy Ave & W Grove St Stop EB 50 75 50 75 25 50 25 50 NB 25 75 25 75 25 50 25 50 SR 0 25 0 25 Tracy Ave & Benton Ave Stop EB 75 150 75 150 75 150 50 100 50 100 50 100 WB 50 125 50 125 50 125 50 75 50 75 50 75 NB 75 175 75 175 75 175 50 100 50 100 50 100 SB 50 100 50 100 50 100 50 100 50 100 50 100 Tracy Ave & SE Entrance/Countryside Rd Stop EB 25 75 25 75 25 75 50 100 50 100 50 100 WB 25 50 25 50 25 50 25 75 25 75 25 75 NB 25 100 25 100 25 100 25 75 25 75 25 75 SB 25 75 25 75 25 75 25 50 25 50 25 50 Stuart Ave & W Grove St Stop EB 0 25 0 2S WB 25 75 25 75 25 25 25 25 NB 25 75 25 75 25 75 2S 75 School Exit & Benton Ave Stop EB WB NB 50 125 50 125 50 100 50 100 Table 4.3. Minimum Recommended Sight Distances Based on Vehicle Maneuver Vehicle Speed (mph) Stopping Sight Distance for Left-Turn Maneuver (feet) Stopping Sight Distance for Crossover and Right-Turn Maneuvers (feet) 15 170 145 20 225 195 1 25 280 240 1 30 335 290 35 390 335 40 445 385 45 5(X) 430 50 555 480 55 610 530 :0 N cc (.5 rossover Maneuver J Left Turn Maneuver < Major Street Tracy Avenue 1— > Right Turn Maneuver Stop Recommendations Based on traffic modeling results, the proposed Countryside Elementary improvements have minimal impact on the adjacent roadway network. The additional entrance shifts bus traffic from the Tracy Avenue and Benton Avenue intersection. The school drop off and the adjacent roadway morning peak hour coincide resulting in the greatest congestion during this 7 am to 8 am time period. • No turn lane improvements are recommended. • The additional full access entrance proposed on Tracy Avenue and the Countryside Road intersection is located at the bottom of a vertical curve, recommended to provide minimum 280 feet sight distance per Table 8 from the AASHTO Green Book - A Policy on Geometric Design of Highways and Streets. On-street parking and landscaping must be located outside the sight triangle at this new entrance location. Table 8: AASHTO Minimum Recommended Sight Distance Figure 3: Maneuvers at Stop Control Intersection Appendix A: Traffic Counts Bolton & MenKr I nc Turning Movement Counts File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code :00000000 :;rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :1 Groups Printed- Cars + - Trucks Start Time Right Thru Tracy Ave From North Left Peds App. Total Right Thru Grove St From East Left Peds App. Total Right Thru Tracy Ave From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 12:15 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 12:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 12:45 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 Total 0 1 0 0 1 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 6 01:00 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 2 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 02:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 03:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 04:00 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 04:15 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 04:30 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 04:45 AM 0 0 0 0 0 0 0 1 0 1 0 1 0 0 1 0 0 0 0 0 2 Total 0 2 0 0 2 0 0 1 0 1 0 3 0 0 3 0 0 0 0 0 6 05:00 AM 0 4 0 0 4 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 4 05:15 AM 0 0 0 0 0 0 0 0 1 1 0 1 0 0 1 0 0 0 0 0 2 05:30 AM 0 3 0 0 3 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 4 05:45 AM 0 4 0 0 4 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 5 Total 0 11 0 0 11 0 0 1 1 2 1 1 0 0 2 0 0 0 0 0 15 06:00 AM 0 3 0 0 3 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 7 06:15 AM 0 5 0 0 5 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 8 06:30 AM 0 8 0 0 8 0 0 0 1 1 0 6 0 0 6 0 0 0 0 0 15 06:45 AM 0 3 0 0 3 0 0 0 1 1 0 11 0 0 11 0 0 0 0 0 15 Total 0 19 0 0 19 0 0 0 2 2 0 24 0 0 24 0 0 0 0 0 45 Bolton & Menkr nc Turning Movement Counts File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code :00000000 3 rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :2 Groups Printed- Cars + - Trucks Start Time Right Thru Tracy Ave From North Left Peds App. Total Right Thru Grove St From East Left Peds App. Total Right Thru Tracy Ave From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:00 AM 0 22 0 0 22 0 0 1 0 1 0 10 0 0 10 0 0 0 0 0 33 07:15 AM 0 33 0 0 33 1 0 0 1 2 0 27 0 0 27 0 0 0 0 0 62 07:30 AM 0 71 2 0 73 2 0 8 9 19 0 57 0 0 57 0 0 0 0 0 149 07:45 AM 0 42 0 0 42 1 0 2 1 4 1 63 0 0 64 0 0 0 0 0 110 Total 0 168 2 0 170 4 0 11 11 26 1 157 0 0 158 0 0 0 0 0 354 08:00 AM 0 34 0 0 34 0 0 2 0 2 0 26 0 0 26 0 0 0 0 0 62 08:15 AM 0 23 1 0 24 0 0 1 0 1 0 26 0 0 26 0 0 0 0 0 51 08:30 AM 0 21 1 0 22 2 0 2 0 4 0 24 0 0 24 0 0 0 0 0 50 08:45 AM 0 34 1 0 35 0 0 0 1 1 0 21 0 0 21 0 0 0 0 0 57 Total 0 112 3 0 115 2 0 5 1 8 0 97 0 0 97 0 0 0 0 0 220 09:00 AM 0 31 1 0 32 1 0 3 0 4 1 46 0 0 47 0 0 0 0 0 83 09:15 AM 0 21 0 0 21 0 0 0 1 1 2 36 0 0 38 0 0 0 0 0 60 09:30 AM 0 12 0 0 12 1 0 2 2 5 0 12 0 0 12 0 0 0 0 0 29 09:45 AM 0 16 0 0 16 1 0 4 1 6 1 20 0 0 21 0 0 0 0 0 43 Total 0 80 1 0 81 3 0 9 4 16 4 114 0 0 118 0 0 0 0 0 215 10:00 AM 0 15 0 0 15 0 0 0 0 0 1 16 0 0 17 0 0 0 0 0 32 10:15 AM 0 11 0 0 11 0 0 0 0 0 2 15 0 0 17 0 0 0 0 0 28 10:30 AM 0 17 0 0 17 0 0 0 1 1 2 17 0 0 19 0 0 0 0 0 37 10:45 AM 0 9 1 0 10 0 0 0 0 0 0 13 0 0 13 0 0 0 0 0 23 Total 0 52 1 0 53 0 0 0 1 1 5 61 0 0 66 0 0 0 0 0 120 11:00 AM 0 11 0 0 11 0 0 1 1 2 1 17 0 0 18 0 0 0 0 0 31 11:15 AM 0 10 0 0 10 0 0 0 0 0 0 21 0 0 21 0 0 0 0 0 31 11:30 AM 0 17 0 0 17 0 0 2 2 4 1 22 0 0 23 0 0 0 0 0 44 11:45 AM 0 21 0 0 21 0 0 1 0 1 1 18 0 0 19 0 0 0 0 0 41 Total 0 59 0 0 59 0 0 4 3 7 3 78 0 0 81 0 0 0 0 0 147 12:00 PM 0 18 0 0 18 0 0 2 0 2 0 27 0 0 27 0 0 0 0 0 47 12:15 PM 0 4 0 0 4 0 0 0 2 2 0 27 0 0 27 0 0 0 0 0 33 12:30 PM 0 19 0 0 19 0 0 0 0 0 1 22 0 0 23 0 0 0 0 0 42 12:45 PM 0 34 0 0 34 0 0 2 1 3 1 28 0 0 29 0 0 0 0 0 66 Total 0 75 0 0 75 0 0 4 3 7 2 104 0 0 106 0 0 0 0 0 188 01:00 PM 0 29 1 0 30 0 0 0 0 0 0 42 0 0 42 0 0 0 0 0 72 01:15 PM 0 24 0 0 24 0 0 2 0 2 0 25 0 0 25 0 0 0 0 0 51 01:30 PM 0 23 1 0 24 0 0 0 1 1 1 19 0 0 20 0 0 0 0 0 45 01:45 PM 0 22 0 0 22 0 0 2 0 2 0 19 0 0 19 0 0 0 0 0 43 Total 0 98 2 0 100 0 0 4 1 5 1 105 0 0 106 0 0 0 0 0 211 Bolton & Menkr I nc Turning Movement Counts File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code :00000000 grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :3 Groups Printed- Cars + - Trucks Start Time Right Thru Tracy Ave From North Left Peds App. Total Right Thru Grove St From East Left Peds App. Total Right Thru Tracy Ave From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 02:00 PM 0 22 0 0 22 0 0 1 0 1 0 27 0 0 27 0 0 0 0 0 50 02:15 PM 0 37 0 0 37 1 0 2 3 6 0 43 0 0 43 0 0 0 0 0 86 02:30 PM 0 43 0 0 43 2 0 0 1 3 1 44 0 0 45 0 0 0 0 0 91 02:45 PM 0 23 0 0 23 1 0 1 2 4 2 23 0 0 25 0 0 0 0 0 52 Total 0 125 0 0 125 4 0 4 6 14 3 137 0 0 140 0 0 0 0 0 279 03:00 PM 0 18 1 0 19 0 0 2 2 4 0 19 0 0 19 0 0 0 0 0 42 03:15 PM 0 28 0 0 28 0 0 1 1 2 0 46 0 0 46 0 0 0 0 0 76 03:30 PM 0 37 1 0 38 0 0 1 0 1 1 52 0 0 53 0 0 0 0 0 92 03:45 PM 0 35 0 0 35 0 0 6 1 7 2 31 0 0 33 0 0 0 0 0 75 Total 0 118 2 0 120 0 0 10 4 14 3 148 0 0 151 0 0 0 0 0 285 04:00 PM 0 34 0 0 34 1 0 1 1 3 2 34 0 0 36 0 0 0 0 0 73 04:15 PM 0 31 1 0 32 0 0 0 0 0 1 63 0 0 64 0 0 0 0 0 96 04:30 PM 0 27 0 0 27 1 0 1 0 2 2 49 0 0 51 0 0 0 0 0 80 04:45 PM 0 39 0 0 39 1 0 1 0 2 2 40 0 0 42 0 0 0 0 0 83 Total 0 131 1 0 132 3 0 3 1 7 7 186 0 0 193 0 0 0 0 0 332 05:00 PM 0 34 0 0 34 0 0 1 1 2 4 51 0 0 55 0 0 0 0 0 91 05:15 PM 0 20 0 0 20 0 0 4 0 4 1 44 0 0 45 0 0 0 0 0 69 05:30 PM 0 35 1 0 36 0 0 2 2 4 4 32 0 0 36 0 0 0 0 0 76 05:45 PM 0 24 0 0 24 0 0 0 1 1 0 30 0 0 30 0 0 0 0 0 55 Total 0 113 1 0 114 0 0 7 4 11 9 157 0 0 166 0 0 0 0 0 291 06:00 PM 0 14 0 0 14 0 0 2 0 2 0 34 0 0 34 0 0 0 0 0 50 06:15 PM 0 20 0 0 20 0 0 0 0 0 0 24 0 0 24 0 0 0 0 0 44 06:30 PM 0 15 0 0 15 0 0 1 2 3 0 24 0 0 24 0 0 0 0 0 42 06:45 PM 0 12 0 0 12 0 0 0 0 0 0 10 0 0 10 0 0 0 0 0 22 Total 0 61 0 0 61 0 0 3 2 5 0 92 0 0 92 0 0 0 0 0 158 07:00 PM 0 13 0 0 13 0 0 0 0 0 0 11 0 0 11 0 0 0 0 0 24 07:15 PM 0 16 0 0 16 0 0 0 0 0 1 13 0 0 14 0 0 0 0 0 30 07:30 PM 0 9 0 0 9 1 0 0 2 3 1 10 0 0 11 0 0 0 0 0 23 07:45 PM 0 11 0 0 11 0 0 0 0 0 0 14 0 0 14 0 0 0 0 0 25 Total 0 49 0 0 49 1 0 0 2 3 2 48 0 0 50 0 0 0 0 0 102 08:00 PM 0 9 0 0 9 0 0 1 0 1 3 9 0 0 12 0 0 0 0 0 22 08:15 PM 0 11 0 0 11 2 0 1 0 3 1 12 0 0 13 0 0 0 0 0 27 08:30 PM 0 11 0 0 11 0 0 3 0 3 0 6 0 0 6 0 0 0 0 0 20 08:45 PM 0 10 0 0 10 3 0 1 0 4 3 1 0 0 4 0 0 0 0 0 18 Total 0 41 0 0 41 5 0 6 0 11 7 28 0 0 35 0 0 0 0 0 87 = = Bolton & MenIcr nc Turning Movement Counts File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code :00000000 3rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :4 Tracy Ave From North Grove St From East Tracy Ave From South App. Total Thru From West Int. Total Start Time Right Thru Left Peds App. Total Right Thru Left Peds 1 App. Total Right I Thru Left 1 Peds Right Left Peds I App. Total 09:00 PM 0 5 0 0 5 3 0 0 0 3 0 10 0 0 10 0 0 0 0 0 18 09:15 PMI 09:30 PM 0 0 4 7 0 0 0 0 4 7 1 0 0 0 0 0 0 o 1 o 0 0 6 4 0 0 0 0 6 0 4 0 0 0 0 0 0 0 0 0 11 11 09:45 PM 0 2 0 0 2 0 0 0 0 5 0 0 5 0 0 0 0 0 7 Total 0 18 0 0 18 4 0 0 0 4 0 25 0 0 25 0 0 0 0 0 47 10:00 PM 0 0 1 0 1 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 4 10:15 PM 0 4 0 0 4 0 0 0 0 0 1 3 0 0 4 0 0 0 0 0 8 10:30 PM 0 2 0 0 2 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 6 10:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 6 1 0 7 0 0 0 0 0 1 10 0 0 11 0 0 0 0 0 18 11:00 PM 11:15 PM 11:30 PM 0 0 0 3 0 2 0 0 0 0 0 0 3 0 0 0 2 0 0 0 0 0 0 1 0 0 0 0 0 1 0 0 2 0 0 0 0 0 0 0 0 2 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 1 3 11:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 5 0 0 5 0 0 1 0 0 1 2 0 0 3 0 0 0 0 0 9 Grand Total Apprch % 0 0 1347 99 14 1 0 0 1361 26 17.9 0 0 73 50.3 46 31.7 145 50 3.1 1582 96.9 0 0 0 0 1632 0 0 0 0 0 0 0 0 0 3138 Total % 0 42.9 0.4 0 43.4 0.8 26 0 2.3 1.5 4.6 1.6 50.4 0 0 52 0 0 0 0 0 0 Cars + 0 1314 14 0 1328 0 73 46 145 50 1536 0 0 1586 0 0 0 0 3059 % Cars + 0 97.6 100 0 97.6 100 0 100 100 100 100 97.1 0 0 97.2 0 0 0 0 0 97.5 Trucks 0 33 0 0 33 0 0 0 0 0 46 0 0 46 0 0 0 0 0 79 % Trucks 0 2.4 0 0 2.4 0 0 0 0 0 0 2.9 0 0 2.8 0 0 0 0 0 2.5 Groups Printed- Cars + - Trucks Tracy Ave Out In Total 1562 1328 2890 46 33 79 1608 1361 2969 O 1314 14 0 O 33 0 0 O 1347 14 0 Right Thru Left Peds 1 ► Left Thru Right Peds 0 1536 50 0 0 46 0 0 0 1582 50 0 1387 1586 2973 33 46 79 1420 1632 3052 Out In Total Tram/ AVP •?: IC)) 0 6' 0) a) 5.0 I> North 3/29/2022 12:00 AM „ 0 3/29/2022 11:45 PM < 4, 4, co Ct O • C..) 0 Cc) Cars + Trucks o o o 0 0 0 a) 000 0 CD 0 -C ► o o o .- _0 o o '5 0 o o O -0 a) -0 rs, o " o r) a) o CO 0 CO — Ln 0) 0 0) Bolton & Menkr I nc Turning Movement Counts 3rove St and Tracy Ave Edina, MN File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code : 00000000 Start Date : 3/29/2022 Page No : 5 Bolton & Menkr I tic Turning Movement Counts File Name : E Grove and Tracy 24 hr 2022-03-29 Site Code :00000000 grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :6 Tracy Ave From North Start Time Right Thru Left Peds App. Total Peak Hour Analysis From 12:00 AM to 11:45 AM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 07:15 AM Right Thru Grove St From East Left Peds App. Total Right Thru Tracy Ave From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:15 AM 0 33 0 0 33 1 0 0 1 2 0 27 0 0 27 0 0 0 0 0 62 07:30 AM 0 71 2 0 73 2 0 8 9 19 0 57 0 0 57 0 0 0 0 0 149 07:45 AM 0 42 0 0 42 1 0 2 1 4 1 63 0 0 64 0 0 0 0 0 110 08:00 AM 0 34 0 34 0 0 2 0 2 0 26 0 0 26 0 0 0 0 0 62 Total Volume 0 180 2 182 4 0 12 11 27 1 173 0 0 174 0 0 0 0 0 383 oio App. Total 0 __ 98.9 1.1 0 14.8 0 44.4 40.7 0.6 99.4 0 0 0 0 0 0 PHF .000 .634 .250 .000 .623 .500 .000 .375 .306 .355 .250 .687 .000 .000 .680 .000 .000 .000 .000 .000 .643 Cars + 0 170 2 0 172 4 0 12 11 27 1 158 0 0 159 0 0 0 0 0 358 % Cars + 0 94.4 100 0 94.5 100 0 100 100 100 100 91.3 0 0 91.4 0 0 0 0 0 93.5 Trucks 0 10 0 0 10 0 0 0 0 0 0 15 0 0 15 0 0 0 0 0 25 0/0 Trucks 0 5.6 0 0 5.5 0 0 0 0 0 0 8.7 0 0 8.6 0 0 0 0 0 6.5 Peak Hour Analysis From 12:00 PM to 11:45 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 04:15 PM 04:15 PM 0 31 1 0 32 0 0 0 0 0 1 63 0 0 64 0 0 0 0 0 96 04:30 PM 0 27 0 0 27 1 0 1 0 2 2 49 0 0 51 0 0 0 0 0 80 04:45 PM 0 39 0 0 39 1 0 1 0 2 2 40 0 0 42 0 0 0 0 0 83 05:00 PM 0 34 0_ 0 34 0 0 1 1 2 4 51 0 0 55 0 0 0 0 0 91 Total Volume 0 131 1 0 132 2 0 3 1 6 9 203 0 0 212 0 0 0 0 0 350 % App. Total 0 99.2 0.8 0 33.3 0 50 16.7 4.2 95.8 0 0 0 0 0 0 PHF .000 _ .840 .250 .000 .846 .500 .000 .750 .250 .750 .563 .806 .000 .000 .828 .000 .000 .000 .000 .000 .911 Cars + 0 130 1 0 131 2 0 3 1 6 9 196 0 0 205 0 0 0 0 0 342 % Cars + 0 99.2 100 0 99.2 100 0 100 100 100 100 96.6 0 0 96.7 0 0 0 0 0 97.7 Trucks 0 1 0 0 1 0 0 0 0 0 0 7 0 0 7 0 0 0 0 0 8 % Trucks 0 0.8 0 0 0.8 0 0 0 0 0 0 3.4 0 0 3.3 0 0 0 0 0 2.3 Bolton & MenKr nc Turning Movement Counts File Name : w grove and tracy 24 hr 2022-03-29 Site Code : 00000000 N Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 1 Start Time Right _ Thru From North Left Peds From East Right Thru From South Left Peds From West Int. Total App. Total Right Thru Left Peds App. Total App. Total Right Thru Left Peds App. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 12:15 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 12:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 12:45 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 Total 0 1 0 0 1 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 6 01:00 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 2 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 02:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 03:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 04:00 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 04:15 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 04:30 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 04:45 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 Total 0 3 0 0 3 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 6 05:00 AM 0 4 0 0 4 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 5 05:15 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 05:30 AM 0 3 0 0 3 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 4 05:45 AM 0 5 0 0 5 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 6 Total 0 12 0 0 12 0 0 0 0 0 0 2 0 0 2 2 0 0 0 2 16 06:00 AM 0 3 0 0 3 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 7 06:15 AM 0 6 0 0 6 0 0 0 0 0 0 2 1 0 3 0 0 1 0 1 10 06:30 AM 0 8 0 0 8 0 0 0 0 0 0 5 0 0 5 0 0 1 0 1 14 06:45 AM 1 2 0 0 3 0 0 0 0 0 0 11 5 0 16 0 0 0 0 0 19 Total 1 19 0 0 20 0 0 0 0 0 0 22 6 0 28 0 0 2 0 2 50 Groups Printed- Cars + - Trucks Bolton & Menkr nc Turning Movement Counts File Name : w grove and tracy 24 hr 2022-03-29 Site Code :00000000 N Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :2 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:00 AM 1 22 0 0 23 0 0 0 0 0 0 8 1 0 9 4 0 2 0 6 38 07:15 AM 3 28 0 0 31 0 0 0 0 0 0 26 8 0 34 2 0 2 0 4 69 07:30 AM 26 51 0 0 77 0 0 0 0 0 0 52 22 0 74 2 0 6 0 8 159 07:45 AM 6 42 _0 0 48 0 0 0 0 0 0 59 7 0 66 12 0 4 0 16 130 Total 36 143 0 0 179 0 0 0 0 0 0 145 38 0 183 20 0 14 0 34 396 08:00 AM 1 36 0 0 37 0 0 0 0 0 0 25 8 0 33 2 0 1 0 3 73 08:15 AM 5 19 0 0 24 0 0 0 0 0 0 20 5 0 25 3 0 7 0 10 59 08:30 AM 9 14 0 0 23 0 0 0 0 0 0 20 2 0 22 2 0 3 0 5 50 08:45 AM 11 23 0 0 34 0 0 0 0 0 0 17 24 0 41 5 0 4 0 9 84 Total 26 92 0 0 118 0 0 0 0 0 0 82 39 0 121 12 0 15 0 27 266 09:00 AM 9 25 0 1 35 0 0 0 0 0 0 26 11 0 37 22 0 21 0 43 115 09:15 AM 5 16 0 0 21 0 0 0 0 0 0 33 7 0 40 2 0 6 0 8 69 09:30 AM 0 14 0 1 15 0 0 0 0 0 0 11 4 0 15 2 0 0 0 2 32 09:45 AM 2 18 0 0 20 0 0 0 0 0 0 18 2 0 20 1 0 3 0 4 44 Total 16 73 0 2 91 0 0 0 0 0 0 88 24 0 112 27 0 30 0 57 260 10:00 AM 3 11 0 0 14 0 0 0 0 0 0 14 0 0 14 1 0 2 0 3 31 10:15 AM 0 12 0 0 12 0 0 0 0 0 0 16 3 1 20 1 0 2 0 3 35 10:30 AM 2 15 0 0 17 0 0 0 0 0 0 15 1 0 16 2 0 3 0 5 38 10:45 AM 2 7 0 0 9 0 0 0 0 0 0 7 2 0 9 1 0 6 0 7 25 Total 7 45 0 0 52 0 0 0 0 0 0 52 6 1 59 5 0 13 0 18 129 11:00 AM 2 10 0 0 12 0 0 0 0 0 0 16 0 0 16 1 0 2 0 3 31 11:15 AM 2 8 0 0 10 0 0 0 0 0 0 18 0 0 18 1 0 3 0 4 32 11:30 AM 2 17 0 0 19 0 0 0 0 0 0 22 2 0 24 3 0 2 0 5 48 11:45 AM 6 16 0 0 22 0 0 0 0 0 0 16 2 0 18 7 0 3 0 10 50 Total 12 51 0 0 63 0 0 0 0 0 0 72 4 0 76 12 0 10 0 22 161 12:00 PM 1 19 0 2 22 0 0 0 0 0 0 24 1 0 25 2 0 3 0 5 52 12:15 PM 2 2 0 0 4 0 0 0 0 0 0 25 2 0 27 2 0 2 0 4 35 12:30 PM 3 16 0 1 20 0 0 0 0 0 0 24 3 0 27 1 0 0 0 1 48 12:45 PM 16 20 0 0 36 0 0 0 0 0 0 22 16 0 38 2 0 6 0 8 82 Total 22 57 0 3 82 0 0 0 0 0 0 95 22 0 117 7 0 11 0 18 217 01:00 PM 2 27 0 2 31 0 0 0 0 0 0 24 5 0 29 18 0 18 0 36 96 01:15 PM 2 25 0 0 27 0 0 0 0 0 0 22 0 0 22 3 0 3 0 6 55 01:30 PM 0 12 0 0 12 0 0 0 0 0 0 17 2 0 19 3 0 3 0 6 37 01:45 PM 9 15 0 1 25 0 0 0 0 0 0 19 4 0 23 4 0 1 0 5 53 Total 13 79 0 3 95 0 0 0 0 0 0 82 11 0 93 28 0 25 0 53 241 Bolton & Menkr I nc Turning Movement Counts File Name : w grove and tracy 24 hr 2022-03-29 Site Code :00000000 N Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :3 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 02:00 PM 4 20 0 0 24 0 0 0 0 0 0 21 16 2 39 2 0 4 0 6 69 02:15 PM 10 29 0 0 39 0 0 0 0 0 0 36 7 0 43 5 0 7 0 12 94 02:30 PM 5 37 0 0 42 0 0 0 0 0 0 38 8 0 46 7 0 4 0 11 99 02:45 PM 4 20 0 0 24 0 0 0 0 0 0 20 0 0 20 2 0 5 1 8 52 Total 23 106 0 0 129 0 0 0 0 0 0 115 31 2 148 16 0 20 1 37 314 03:00 PM 0 20 0 0 20 0 0 0 0 0 0 18 5 0 23 4 0 1 0 5 48 03:15 PM 3 26 0 1 30 0 0 0 0 0 0 45 6 0 51 2 0 1 0 3 84 03:30 PM 5 33 0 0 38 0 0 0 0 0 0 50 3 0 53 3 0 3 0 6 97 03:45 PM 1 40 0 1 42 0 0 0 0 0 0 32 1 0 33 2 0 1 0 3 78 Total 9 119 0 2 130 0 0 0 0 0 0 145 15 0 160 11 0 6 0 17 307 04:00 PM 2 33 0 0 35 0 0 0 0 0 0 35 1 0 36 3 0 1 0 4 75 04:15 PM 3 28 0 0 31 0 0 0 0 0 0 61 2 0 63 6 0 3 0 9 103 04:30 PM 2 26 0 0 28 0 0 0 0 0 0 50 3 0 53 5 0 1 0 6 87 04:45 PM _ 2 38 0 0 40 0 0 0 0 0 0 41 4 0 45 1 0 2 0 3 88 Total 9 125 0 0 134 0 0 0 0 0 0 187 10 0 197 15 0 7 0 22 353 05:00 PM 3 33 0 0 36 0 0 0 0 0 0 50 1 0 51 4 0 5 0 9 96 05:15 PM 2 21 0 0 23 0 0 0 0 0 0 41 1 0 42 1 0 5 0 6 71 05:30 PM 8 29 0 0 37 0 0 0 0 0 0 31 2 0 33 1 0 4 0 5 75 05:45 PM 6 18 0 0 24 0 0 0 0 0 0 29 3 0 32 3 0 1 0 4 60 Total 19 101 0 0 120 0 0 0 0 0 0 151 7 0 158 9 0 15 0 24 302 06:00 PM 3 13 0 0 16 0 0 0 0 0 0 32 3 0 35 1 0 3 0 4 55 06:15 PM 3 17 0 0 20 0 0 0 0 0 0 20 3 0 23 5 0 2 0 7 50 06:30 PM 1 14 0 0 15 0 0 0 0 0 0 24 2 0 26 1 0 1 0 2 43 06:45 PM 2 10 0 0 12 0 0 0 0 0 0 11 2 0 13 1 0 0 0 1 26 Total 9 54 0 0 63 0 0 0 0 0 0 87 10 0 97 8 0 6 0 14 174 07:00 PM 4 9 0 0 13 0 0 0 0 0 0 10 3 0 13 1 0 3 0 4 30 07:15 PM 2 14 0 0 16 0 0 0 0 0 0 12 0 0 12 0 0 2 0 2 30 07:30 PM 1 8 0 0 9 0 0 0 0 0 0 11 1 0 12 0 0 0 0 0 21 07:45 PM 3_ 8 _0 0 11 0 0 0 0 0 0 13 5 0 18 0 0 1 0 1 30 Total 10 39 0 0 49 0 0 0 0 0 0 46 9 0 55 1 0 6 0 7 111 08:00 PM 2 8 0 0 10 0 0 0 0 0 0 9 2 0 11 4 0 3 0 7 28 08:15 PM 0 12 0 0 12 0 0 0 0 0 0 13 4 0 17 1 0 0 0 1 30 08:30 PM 0 6 0 0 6 0 0 0 0 0 0 11 0 0 11 0 0 0 0 0 17 08:45 PM 0 11 0 0 11 0 0 0 0 0 0 4 1 0 5 1 0 0 0 1 17 Total 2 37 0 0 39 0 0 0 0 0 0 37 7 0 44 6 0 3 0 9 92 Bolton & Menkr I ric Turning Movement Counts File Name : w grove and tracy 24 hr 2022-03-29 Site Code :00000000 N Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :4 Groups Printed- Cars + - Trucks Start Time Right Thru From North _ Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 09:00 PM 0 5 0 0 5 0 0 0 0 0 0 9 3 0 12 1 0 1 0 2 19 09:15 PM 2 2 0 0 4 0 0 0 0 0 0 7 1 0 8 0 0 0 0 0 12 09:30 PM 4 3 0 0 7 0 0 0 0 0 0 4 0 0 4 1 0 0 0 1 12 09:45 PM 0 2 0 0 2 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 7 Total 6 12 0 0 18 0 0 0 0 0 0 25 4 0 29 2 0 1 0 3 50 10:00 PM 0 0 0 0 0 0 0 0 0 0 0 4 1 0 5 0 0 0 0 0 5 10:15 PM 2 2 0 0 4 0 0 0 0 0 0 3 0 0 3 0 0 1 0 1 8 10:30 PM 1 1 0 0 2 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 6 10:45 PM 0 0 o 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 3 3 0 0 6 0 0 0 0 0 0 11 1 0 12 0 0 1 0 1 19 11:00 PM 0 3 0 0 3 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 5 11:15 PM 0 0 0 0 0 0 0 0 0 0 0 1 1 0 2 0 0 0 0 0 2 11:30 PM 0 3 0 0 3 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 4 11:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 6 0 0 6 0 0 0 0 0 0 3 2 0 5 0 0 0 0 0 11 Grand Total 223 1180 0 10 1413 0 0 0 0 0 0 1455 246 3 1704 181 0 185 1 367 3484 Apprch % 15.8 83.5 0 0.7 0 0 0 0 0 85.4 14.4 0.2 49.3 0 50.4 0.3 Total % 6.4 33.9 0 0.3 40.6 0 0 0 0 0 0 41.8 7.1 0.1 48.9 5.2 0 5.3 0 10.5 Cars + 215 1157 0 10 1382 0 0 0 0 0 0 1413 230 3 1646 179 0 184 1 364 3392 % Cars + 96.4 98.1 0 100 97.8 0 0 0 0 0 0 97.1 93.5 100 96.6 98.9 0 99.5 100 99.2 97.4 Trucks 8 23 0 0 31 0 0 0 0 0 0 42 16 0 58 2 0 1 0 3 92 % Trucks 3.6 1.9 0 0 2.2 0 0 0 0 0 0 2.9 6.5 0 3.4 1.1 0 0.5 0 0.8 2.6 O 0 0 00 0 Out In Total 1597 1382 2979 43 31 74 1640 1413 3053 215 1157 0 10 8 23 0 0 223 1180 0 10 Right Thru Left Peds Left Thru Right Peds 230 1413 0 3 16 42 0, 0 246 1455 0 3 1336 1646 2982 25 58 83 1361 1704 3065 Out In Total 0 0 0 = -C ► 1— CD CV N. CO -C cr 0 -5 Cr N CD 0 a) North 3/29/2022 12:00 AM 3/29/2022 11:45 PM Cars + Trucks '4' CO CO E m CO 7° o§ — 0 co J 0 0 •?:0 10 0 0 0 0 0 O 00 0 0 -o 0. Bolton & Menkr I nc Turning Movement Counts N Grove St and Tracy Ave Edina, MN File Name : w grove and tracy 24 hr 2022-03-29 Site Code : 00000000 Start Date : 3/29/2022 Page No : 5 Bolton & MenIcr I nc Turning Movement Counts File Name : w grove and tracy 24 hr 2022-03-29 Site Code :00000000 N Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :6 From North Start Time Right Thru Left Peds App. Total eak Hour Analysis From 12:00 AM to 12:00 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 07:15 AM Right From East Thru Left Peds App. Total Right From South Thru Left Peds From West Int. Total App. Total Right Thru Left Peds App. Total 07:15 AM 3 28 0 0 31 0 0 0 0 0 0 26 8 0 34 2 0 2 0 4 69 07:30 AM 26 51 0 0 77 0 0 0 0 0 0 52 22 0 74 2 0 6 0 8 159 07:45 AM 6 42 0 0 48 0 0 0 0 0 0 59 7 0 66 12 0 4 0 16 130 08:00 AM 1 36 0 0 37 0 0 0 0 0 0 25 8 0 33 2 0 1 0 3 73 Total Volume 36 157 0 0 193 0 0 0 0 0 0 162 45 0 207 18 0 13 0 31 431 % App. Total 18.7 81.3 0 0 0 0 0 0 0 78.3 21.7 0 58.1 0 41.9 0 PHF .346 .770 .000 .000 .627 .000 .000 .000 .000 .000 .000 .686 .511 .000 .699 .375 .000 .542 .000 .484 .678 Cars + 32 153 0 0 185 0 0 0 0 0 0 147 39 0 186 18 0 13 0 31 402 % Cars + 88.9 97.5 0 0 95.9 0 0 0 0 0 0 90.7 86.7 0 89.9 100 0 100 0 100 93.3 Trucks 4 4 0 0 8 0 0 0 0 0 0 15 6 0 21 0 0 0 0 0 29 % Trucks 11.1 2.5 00 4.1 0 0 0 0 0 0 9.3 13.3 0 10.1 0 0 0 0 0 6.7 Peak Hour Analysis From 12:15 PM to 11:45 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 04:15 PM 04:15 PM 3 28 0 0 31 0 0 0 0 0 0 61 2 0 63 6 0 3 0 9 103 04:30 PM 2 26 0 0 28 0 0 0 0 0 0 50 3 0 53 5 0 1 0 6 87 04:45 PM 2 38 0 0 40 0 0 0 0 0 0 41 4 0 45 1 0 2 0 3 88 05:00 PM 3 33 o_ 0 36 0 0 0 0 0 0 50 1 0 51 4 0 5 0 9 96 Total Volume 10 125 0 0 135 0 0 0 0 0 0 202 10 0 212 16 0 11 0 27 374 % App. Total 7.4 92.6 0 0 0 0 0 0 0 95.3 4.7 0 59.3 0 40.7 0 PHF .833 .822 .000 .000 .844 .000 .000 .000 .000 .000 .000 .828 .625 .000 .841 .667 .000 .550 .000 .750 .908 Cars + 10 124 0 0 134 0 0 0 0 0 0 195 10 0 205 15 0 11 0 26 365 % Cars + 100 99.2 0 0 99.3 0 0 0 0 0 0 96.5 100 0 96.7 93.8 0 100 0 96.3 97.6 Trucks 0 1 0 0 1 0 0 0 0 0 0 7 0 0 7 1 0 0 0 1 9 "Y. Trucks 0 0.8 0 0 0.7 0 0 0 0 0 0 3.5 0 0 3.3 6.3 0 0 0 3.7 2.4 Bolton & Menkr nc Turning Movement Counts File Name : Benton and Tracy 24 hr 2022-03-29 Site Code :00000000 Benton Ave and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 1 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 12:15 AM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 12:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 12:45 AM 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 Total 0 1 0 0 1 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 6 01:00 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 2 0 0 2 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 2 02:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 1 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 o 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 1 0 0 1 2 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:30 AM 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 04:00 AM 0 1 0 0 1 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 2 04:15 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 04:30 AM 0 0 0 0 0 0 0 0 0 0 1 1 0 0 2 0 0 0 0 0 2 04:45 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 Total 0 3 0 0 3 0 0 0 0 0 2 3 0 0 5 0 0 0 0 0 8 05:00 AM 0 4 1 0 5 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 6 05:15 AM 0 0 0 0 0 0 0 0 0 0 1 1 0 0 2 0 0 0 0 0 2 05:30 AM 0 3 0 0 3 0 0 0 1 1 0 1 0 0 1 0 0 0 0 0 5 05:45 AM 1 4 1 0 6 0 0 4 0 4 0 0 0 0 0 0 2 0 0 2 12 Total 1 11 2 0 14 0 0 5 1 6 1 2 0 0 3 0 2 0 0 2 25 06:00 AM 0 3 0 0 3 0 1 2 0 3 1 4 1 0 6 0 0 0 0 0 12 06:15 AM 0 5 1 0 6 0 0 3 0 3 1 3 0 0 4 0 0 0 0 0 13 06:30 AM 1 5 1 0 7 0 1 7 2 10 4 6 3 0 13 1 0 0 0 1 31 06:45 AM 1 1 0 0 2 0 0 2 2 4 5 15 8 1 29 0 0 1 0 1 36 Total 2 14 2 0 18 0 2 14 4 20 11 28 12 1 52 1 0 1 0 2 92 Bolton & Menkr I ne Turning Movement Counts File Name : Benton and Tracy 24 hr 2022-03-29 Site Code :00000000 Benton Ave and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :2 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right _ From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:00 AM 10 11 5 1 27 2 2 0 0 4 7 8 12 0 27 1 0 0 0 1 59 07:15 AM 11 20 0 0 31 3 4 4 1 12 7 27 19 0 53 4 1 4 0 9 105 07:30 AM 20 31 3 1 55 12 8 20 9 49 10 35 22 10 77 30 19 26 0 75 256 07:45 AM 6 42 6 0 54 8 5 28 3 44 11 30 10 3 54 38 10 27 0 75 227 Total 47 104 14 2 167 25 19 52 13 109 35 100 63 13 211 73 30 57 0 160 647 08:00 AM 1 32 5 1 39 11 0 11 0 22 12 22 3 1 38 1 0 1 1 3 102 08:15 AM 0 17 7 0 24 5 2 11 0 18 16 19 5 0 40 1 0 0 0 1 83 08:30 AM 0 12 4 0 16 2 0 12 0 14 18 21 0 0 39 1 0 0 0 1 70 08:45 AM _ 0 22 5 0 27 8 0 16 0 24 14 32 0 3 49 0 0 1 3 4 104 Total 1 83 21 1 106 26 2 50 0 78 60 94 8 4 166 3 0 2 4 9 359 09:00 AM 1 39 9 0 49 8 0 28 1 37 22 25 3 0 50 1 0 3 0 4 140 09:15 AM 1 16 1 1 19 3 1 13 0 17 9 35 3 0 47 2 2 3 0 7 90 09:30 AM 0 14 2 0 16 1 1 11 0 13 5 14 2 0 21 3 0 0 0 3 53 09:45 AM 1 17 1 0 19 3 0 9 0 12 6 16 3 0 25 3 1 0 0 4 60 Total 3 86 13 1 103 15 2 61 1 79 42 90 11 0 143 9 3 6 0 18 343 10:00 AM 3 9 0 0 12 1 1 10 0 12 6 13 1 0 20 0 0 1 0 1 45 10:15 AM 1 11 1 0 13 3 0 8 0 11 6 14 1 0 21 1 2 1 0 4 49 10:30 AM 0 14 0 1 15 3 0 6 1 10 10 12 0 0 22 2 0 0 0 2 49 10:45 AM 2 8 0 0 10 0 0 7 1 8 6 6 1 0 13 0 0 3 0 3 34 Total 6 42 1 1 50 7 1 31 2 41 28 45 3 0 76 3 2 5 0 10 177 11:00 AM 1 9 1 0 11 4 0 9 1 14 2 12 1 0 15 0 1 0 0 1 41 11:15 AM 0 9 0 0 9 0 0 6 0 6 5 17 0 0 22 0 0 1 0 1 38 11:30 AM 0 17 2 0 19 2 0 9 1 12 3 22 3 0 28 4 0 0 0 4 63 11:45 AM 1 18 4 0 23 2 1 9 0 12 12 15 1 0 28 2 1 1 0 4 67 Total 2 53 7 0 62 8 1 33 2 44 22 66 5 0 93 6 2 2 0 10 209 12:00 PM 1 19 2 0 22 3 1 11 0 15 9 22 0 0 31 1 0 0 0 1 69 12:15 PM 0 4 0 0 4 5 1 15 2 23 4 21 1 0 26 2 0 1 0 3 56 12:30 PM 1 14 2 0 17 6 0 11 0 17 6 18 2 0 26 0 3 4 0 7 67 12:45 PM 0 21 1 1 23 5 1 5 0 11 7 31 1 0 39 1 2 2 0 5 78 Total 2 58 5 1 66 19 3 42 2 66 26 92 4 0 122 4 5 7 0 16 270 01:00 PM 3 34 8 0 45 8 0 8 0 16 10 19 2 0 31 2 0 0 0 2 94 01:15 PM 1 25 2 0 28 2 3 8 0 13 6 19 1 0 26 1 0 1 0 2 69 01:30 PM 4 10 1 0 15 1 1 7 1 10 8 18 4 0 30 1 0 1 0 2 57 01:45 PM 2 16 0 0 18 2 3 4 0 9 4 23 7 0 34 0 0 1 0 1 62 Total 10 85 11 0 106 13 7 27 1 48 28 79 14 0 121 4 0 3 0 7 282 Bolton & Menkr nc Turning Movement Counts File Name : Benton and Tracy 24 hr 2022-03-29 Site Code :00000000 Benton Ave and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :3 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 02:00 PM 3 18 1 0 22 5 1 16 5 27 6 29 13 1 49 5 2 1 0 8 106 02:15 PM 10 23 1 0 34 4 0 10 13 27 13 28 7 11 59 11 5 12 0 28 148 02:30 PM 2 33 11 0 46 7 2 4 5 18 9 22 2 5 38 25 7 17 0 49 151 02:45 PM 0 17 5 1 23 2 1 7 2 12 16 19 0 0 35 4 3 0 2 9 79 Total 15 91 18 1 125 18 4 37 25 84 44 98 22 17 181 45 17 30 2 94 484 03:00 PM 1 21 1 0 23 5 1 13 5 24 11 17 0 2 30 5 0 0 0 5 82 03:15 PM 6 16 6 0 28 11 4 22 2 39 3 37 6 1 47 3 2 3 0 8 122 03:30 PM 3 29 5 0 37 2 2 19 0 23 23 37 5 0 65 18 7 14 0 39 164 03:45 PM 0 38 3 0 41 4 2 24 0 30 26 29 1 0 56 9 0 0 0 9 136 Total 10 104 15 0 129 22 9 78 7 116 63 120 12 3 198 35 9 17 0 61 504 04:00 PM 3 28 4 0 35 3 3 30 0 36 15 31 5 0 51 6 1 2 0 9 131 04:15 PM 4 19 12 0 35 8 3 20 0 31 16 49 4 4 73 4 5 7 4 20 159 04:30 PM 11 15 5 26 57 5 3 11 0 19 12 38 7 1 58 9 3 9 0 21 155 04:45 PM 9 27 3 0 39 4 3 11 0 18 15 33 4 0 52 9 5 9 0 23 132 Total 27 89 24 26 166 20 12 72 0 104 58 151 20 5 234 28 14 27 4 73 577 05:00 PM 5 25 7 0 37 3 3 13 0 19 25 39 4 0 68 8 5 9 0 22 146 05:15 PM 1 18 2 9 30 6 4 14 14 38 22 30 3 14 69 3 2 6 0 11 148 05:30 PM 5 25 2 0 32 6 3 17 0 26 24 23 2 0 49 2 1 5 0 8 115 05:45 PM 1 16 4 0 21 3 2 16 0 21 19 23 0 0 42 10 4 5 0 19 103 Total 12 84 15 9 120 18 12 60 14 104 90 115 9 14 228 23 12 25 0 60 512 06:00 PM 0 12 2 0 14 10 0 11 0 21 10 25 0 0 35 1 0 0 0 1 71 06:15 PM 0 16 4 0 20 3 0 11 0 14 8 23 0 0 31 0 0 0 0 0 65 06:30 PM 0 15 1 0 16 6 0 9 1 16 8 17 1 0 26 0 0 0 0 0 58 06:45 PM_ 0 8 3 0 11 1 0 10 0 11 10 11 1 0 22 2 0 1 0 3 47 Total 0 51 10 0 61 20 0 41 1 62 36 76 2 0 114 3 0 1 0 4 241 07:00 PM 0 8 2 0 10 2 1 9 0 12 2 11 1 0 14 0 0 0 0 0 36 07:15 PM 0 13 1 0 14 0 1 6 1 8 5 12 0 1 18 1 0 0 0 1 41 07:30 PM 0 7 2 0 9 3 0 5 0 8 8 10 0 0 18 0 0 0 0 0 35 07:45 PM 0 8 0 0 8 1 0 4 0 5 8 17 0 0 25 0 0 0 0 0 38 Total 0 36 5 0 41 6 2 24 1 33 23 50 1 1 75 1 0 0 0 1 150 08:00 PM 0 11 1 0 12 2 1 10 0 13 5 9 0 0 14 1 0 0 0 1 40 08:15 PM 0 12 1 0 13 1 0 1 0 2 2 17 2 0 21 0 0 0 0 0 36 08:30 PM 0 5 1 0 6 2 1 5 0 8 5 8 2 0 15 1 0 0 0 1 30 08:45 PM 0 11 0 0 11 0 0 7 0 7 4 5 0 0 9 0 0 0 0 0 27 Total 0 39 3 0 42 5 2 23 0 30 16 39 4 0 59 2 0 0 0 2 133 Bolton & Menkr I ric Turning Movement Counts File Name : Benton and Tracy 24 hr 2022-03-29 Site Code :00000000 Benton Ave and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :4 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 09:00 PM 0 4 2 0 6 0 0 3 0 3 5 12 0 18 1 0 0 0 1 28 09:15 PM 0 3 0 0 3 0 0 2 0 2 0 8 0 0 8 0 0 0 0 0 13 09:30 PM 0 3 1 0 4 1 0 1 0 2 1 3 0 0 4 0 0 0 0 0 10 09:45 PM 0 2 0 0 2 1 0 4 0 5 1 4 0 0 5 0 0 0 0 0 12 Total 0 12 3 0 15 2 0 10 0 12 7 27 1 0 35 1 0 0 0 1 63 10:00 PM 0 0 0 0 0 0 0 0 0 0 2 5 0 0 7 0 0 0 0 0 7 10:15 PM 0 2 0 0 2 1 0 0 0 1 3 3 0 0 6 0 0 0 0 0 9 10:30 PM 0 1 0 0 1 0 0 0 0 0 1 2 0 0 3 1 0 1 0 2 6 10:45 PM 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 1 Total 0 3 0 0 3 1 0 0 0 1 7 10 0 0 17 1 0 1 0 2 23 11:00 PM 0 3 0 0 3 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 5 11:15 PM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 11:30 PM 0 3 0 0 3 0 0 1 0 1 0 1 0 0 1 0 0 0 0 0 5 11:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 6 0 0 6 0 0 1 0 1 0 5 0 0 5 0 0 0 0 0 12 Grand Total 138 1057 170 42 1407 225 78 661 74 1038 599 1295 192 58 2144 242 97 184 10 533 5122 Apprch % 9.8 75.1 12.1 3 21.7 7.5 63.7 7.1 27.9 60.4 9 2.7 45.4 18.2 34.5 1.9 Total % 2.7 20.6 3.3 0.8 27.5 4.4 1.5 12.9 1.4 20.3 11.7 25.3 3.7 1.1 41.9 4.7 1.9 3.6 0.2 10.4 Cars + 136 1035 167 42 1380 219 78 636 74 1007 574 1253 188 57 2072 232 89 172 9 502 4961 % Cars + 98.6 97.9 98.2 100 98.1 97.3 100 96.2 100 97 95.8 96.8 97.9 98.3 96.6 95.9 91.8 93.5 90 94.2 96.9 Trucks 2 22 3 0 27 6 0 25 0 31 25 42 4 1 72 10 8 12 1 31 161 % Trucks 1.4 2.1 1.8 0 1.9 2.7 0 3.8 0 3 4.2 3.2 2.1 1.7 3.4 4.1 8.2 6.5 10 5.8 3.1 Out In Total 1644 1380 3024 60 27 87 1704 1407 3111 136 1035 167 42 2 22 3 0 138 1057 170 42 Right Thru Left Peds 4 4 Left Thru Right Peds 188 1253 574 57 4 42 25, 1 192 1295 599 58 1903 2072 3975 57 72 129 1960 2144 4104 Out In Total N N M CD CO nt CO DO) a) •r- rJ • Do a- \ ND (▪ 1`,1 0, 8 CD 2CO CZ CO CT) 0) Cr, 0 8 05 CO CZ 0 CO cocor--- oo co 2 cv .--- co .c co co Cr) i•-- c Lo La m o at N N N CD CO .5 0 0 0 0 `r -o cu North 3/29/2022 12:00 AM 3/29/2022 11:45 PM Cars + Trucks 4 2 CO 0 CO - CT) 0) ▪ -6 Cll rs) CO 0) -o co oco CO 1:1).9. co ro A V -P.. 0 A Bolton & Menkr I nc Turning Movement Counts 3enton Ave and Tracy Ave Edina, MN File Name : Benton and Tracy 24 hr 2022-03-29 Site Code : 00000000 Start Date : 3/29/2022 Page No : 5 Bolton & MenIcr I nc Turning Movement Counts File Name : Benton and Tracy 24 hr 2022-03-29 Site Code :00000000 3enton Ave and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :6 From North Start Time _ Right Thru Left Peds App. Total Peak Hour Analysis From 12:00 AM to 12:00 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 07:15 AM Right Thru From East Left Peds App. Total Right Thru From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:15 AM 11 20 0 0 31 3 4 4 1 12 7 27 19 0 53 4 1 4 0 9 105 07:30 AM 20 31 3 1 55 12 8 20 9 49 10 35 22 10 77 30 19 26 0 75 256 07:45 AM 6 42 6 0 54 8 5 28 3 44 11 30 10 3 54 38 10 27 0 75 227 08:00 AM 1 32 5 1 39 11 0 11 0 22 12 22 3 1 38 1 0 1 1 3 102 Total Volume 38 125 14 2 179 34 17 63 13 127 40 114 54 14 222 73 30 58 1 162 690 % App. Total 21.2 69.8 7.8 1.1 26.8 13.4 49.6 10.2 18 51.4 24.3 6.3 45.1 18.5 35.8 0.6 PHF .475 .744 .583_ .500 .814 .708 .531 .563 .361 .648 .833 .814 .614 .350 .721 .480 .395 .537 .250 .540 .674 Cars + 38 120 14 2 174 30 17 59 13 119 40 104 54 14 212 72 24 51 1 148 653 % Cars + 100 96.0 100 100 97.2 88.2 100 93.7 100 93.7 100 91.2 100 100 95.5 98.6 80.0 87.9 100 91.4 94.6 Trucks 0 5 0 0 5 4 0 4 0 8 0 10 0 0 10 1 6 7 0 14 37 % Trucks 0 4.0 0 0 2.8 11.8 0 6.3 0 6.3 0 8.8 0 0 4.5 1.4 20.0 12.1 0 8.6 5.4 Peak Hour Analysis From 12:15 PM to 11:45 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 04:15 PM 04:15 PM 4 19 12 0 35 8 3 20 0 31 16 49 4 4 73 4 5 7 4 20 159 04:30 PM 11 15 5 26 57 5 3 11 0 19 12 38 7 1 58 9 3 9 0 21 155 04:45 PM 9 27 3 0 39 4 3 11 0 18 15 33 4 0 52 9 5 9 0 23 132 05:00 PM 5 25 7 0 37 3 3 13 0 19 25 39 4 0 68 8 5 9 0 22 146 Total Volume 29 86 27 26 168 20 12 55 0 87 68 159 19 5 251 30 18 34 4 86 592 % App. Total 17.3 51.2 16.1 15.5 23 13.8 63.2 0 27.1 63.3 7.6 2 34.9 20.9 39.5 4.7 PHF .659 .796 .563 .250 .737 .625 1.00 .688 .000 .702 .680 .811 .679 .313 .860 .833 .900 .944 .250 .935 .931 Cars + 29 84 27 26 166 19 12 51 0 82 65 153 19 5 242 30 18 34 4 86 576 % Cars + 100 97.7 100 100 98.8 95.0 100 92.7 0 94.3 95.6 96.2 100 100 96.4 100 100 100 100 100 97.3 Trucks 0 2 0 0 2 1 0 4 0 5 3 6 0 0 9 0 0 0 0 0 16 °A Trucks 0 2.3 0 0 1.2 5.0 0 7.3 0 5.7 4.4 3.8 0 0 3.6 0 0 0 0 0 2.7 Bolton & Menk, I nc Turning Movement Counts File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 1 Groups Printed- Cars + - Trucks Start Time Right _ From North Thru Left Peds App. Total Right Thru From East_ Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 12:15 AM 0 0 0 0 0 0 0 1 1 2 0 1 0 0 1 0 0 0 0 0 3 12:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 12:45 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 Total 0 1 0 0 1 0 0 1 1 2 0 5 0 0 5 0 0 0 0 0 8 01:00 AM 0 1 0 0 1 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 2 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 01:45 AM 0 0 0 0 0 0 0 0 0 0 1 1 0 0 2 0 0 0 0 0 2 Total 0 2 0 0 2 0 0 0 0 0 2 1 0 0 3 0 0 0 0 0 5 02:00 AM 0 1 0 0 1 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 3 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 1 0 0 1 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 3 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:30 AM 0 2 0 0 2 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 3 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 2 0 0 2 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 3 04:00 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 04:15 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 04:30 AM 0 0 0 0 0 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 04:45 AM 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 2 Total 0 3 0 0 3 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 8 05:00 AM 0 5 0 0 5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 5 05:15 AM 0 0 0 0 0 1 0 0 1 2 0 1 0 0 1 0 0 0 0 0 3 05:30 AM 0 3 0 0 3 0 0 1 1 2 0 1 0 0 1 0 0 0 0 0 6 05:45 AM 0 8 0 0 8 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 8 Total 0 16 0 0 16 1 0 1 2 4 0 2 0 0 2 0 0 0 0 0 22 06:00 AM 0 5 0 0 5 0 0 1 0 1 0 6 0 0 6 0 0 0 0 0 12 06:15 AM 0 8 0 0 8 0 0 1 0 1 0 5 0 0 5 0 0 0 0 0 14 06:30 AM 0 12 1 0 13 1 0 0 0 1 0 11 0 0 11 0 0 0 0 0 25 06:45 AM 0 4 0 0 4 0 0 1 1 2 0 27 0 0 27 0 0 0 0 0 33 Total 0 29 1 0 30 1 0 3 1 5 0 49 0 0 49 0 0 0 0 0 84 Bolton & Merit(' I c Turning Movement Counts File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 2 Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds From South From West Int. Total App. Total Right _ Thru Left Peds App. Total Right Thru Left Peds App. Total 07:00 AM 0 12 0 0 12 0 0 1 0 1 0 31 0 0 31 0 0 0 0 0 44 07:15 AM 0 27 0 0 27 1 0 1 1 3 0 54 0 2 56 0 0 0 0 0 86 07:30 AM 0 70 4 0 74 3 0 0 5 8 7 69 0 32 108 0 0 0 0 0 190 07:45 AM 0 107 3 0 110 2 0 5 2 9 3 42 0 2 47 0 0 0 0 0 166 Total 0 216 7 0 223 6 0 7 8 21 10 196 0 36 242 0 0 0 0 0 486 08:00 AM 0 41 2 0 43 2 0 7 0 9 3 34 0 0 37 0 0 0 0 0 89 08:15 AM 0 28 1 0 29 0 0 1 0 1 3 42 0 0 45 0 0 0 0 0 75 08:30 AM 0 24 1 0 25 0 0 2 0 2 0 36 0 0 36 0 0 0 0 0 63 08:45 AM 0_ 39 0 0 39 1 0 2 1 4 2 45 0 0 47 0 0 0 0 0 90 Total 0 132 4 0 136 3 0 12 1 16 8 157 0 0 165 0 0 0 0 0 317 09:00 AM 0 65 1 0 66 0 0 2 0 2 2 50 0 0 52 0 0 0 0 0 120 09:15 AM 0 30 0 0 30 1 0 2 0 3 1 46 0 0 47 0 0 0 0 0 80 09:30 AM 0 29 1 0 30 0 0 3 0 3 1 21 0 0 22 0 0 0 0 0 55 09:45 AM 0__ 29 0 0 29 0 0 0 0 0 2 25 0 0 27 0 0 0 0 0 56 Total 0 153 2 0 155 1 0 7 0 8 6 142 0 0 148 0 0 0 0 0 311 10:00 AM 0 18 1 0 19 1 0 1 1 3 2 20 0 0 22 0 0 0 0 0 44 10:15 AM 0 20 0 0 20 1 0 1 0 2 2 20 0 0 22 0 0 0 0 0 44 10:30 AM 0 22 0 0 22 0 0 2 0 2 1 22 0 0 23 0 0 0 0 0 47 10:45 AM 0 15 0 0 15 2 0 2 1 5 2 12 0 0 14 0 0 0 0 0 34 Total 0 75 1 0 76 4 0 6 2 12 7 74 0 0 81 0 0 0 0 0 169 11:00 AM 0 17 1 0 18 0 0 2 2 4 1 15 0 0 16 0 0 0 0 0 38 11:15 AM 0 13 0 0 13 0 0 2 0 2 4 22 0 0 26 0 0 0 0 0 41 11:30 AM 0 32 0 0 32 1 0 0 1 2 2 27 0 0 29 0 0 0 0 0 63 11:45 AM 0 28 1 0 29 0 0 2 0 2 0 29 0 0 29 0 0 0 0 0 60 Total 0 90 2 0 92 1 0 6 3 10 7 93 0 0 100 0 0 0 0 0 202 12:00 PM 0 27 2 0 29 1 0 0 0 1 1 28 0 0 29 0 0 0 0 0 59 12:15 PM 0 12 1 0 13 1 0 5 0 6 0 26 0 0 26 0 0 0 0 0 45 12:30 PM 0 25 0 0 25 0 0 1 0 1 1 25 0 0 26 0 0 0 0 0 52 12:45 PM 17 0 0 17 1 0 2 0 3 4 39 0 0 43 0 0 0 0 0 63 Total 81 3 0 84 3 0 8 0 11 6 118 0 0 124 0 0 0 0 0 219 01:00 PM 0 44 0 0 44 0 0 0 0 0 2 31 0 0 33 0 0 0 0 0 77 01:15 PM 0 33 1 0 34 0 0 1 0 1 1 26 0 1 28 0 0 0 0 0 63 01:30 PM 0 18 0 0 18 2 0 1 1 4 0 29 0 1 30 0 0 0 0 0 52 01:45 PM 0 18 0 0 18 0 0 0 0 0 1 38 0 0 39 0 0 0 0 0 57 Total 0 113 1 0 114 2 0 2 1 5 4 124 0 2 130 0 0 0 0 0 249 Groups Printed- Cars + - Trucks Bolton & Menkr nc Turning Movement Counts File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 3 Groups Printed- Cars + - Trucks Start Time Right Thru From North Left Peds From East Right Thru From South Left Peds App. Total Right Thru From West Left Peds App. Total Int. Total App. Total Right Thru Left Peds App. Total 02:00 PM 0 30 0 0 30 1 0 0 5 6 2 49 0 0 51 0 0 0 0 0 87 02:15 PM 0 48 3 0 51 3 0 3 7 13 2 43 0 48 93 0 0 0 0 0 157 02:30 PM 0 66 2 0 68 0 0 6 2 8 0 31 0 3 34 0 0 0 0 0 110 02:45 PM 0 28 1 0 29 0 0 2 0 2 1 35 0 0 36 0 0 0 0 0 67 Total 0 172 6 0 178 4 0 11 14 29 5 158 0 51 214 0 0 0 0 0 421 03:00 PM 0 37 1 0 38 1 0 2 2 5 1 28 0 0 29 0 0 0 0 0 72 03:15 PM 0 41 0 0 41 3 0 0 0 3 2 56 0 0 58 0 0 0 0 0 102 03:30 PM 0 59 4 0 63 1 0 1 0 2 7 57 0 0 64 0 0 0 0 0 129 03:45 PM 0 72 0 0 72 1 0 3 0 4 3 57 0 0 60 0 0 0 0 0 136 Total 0 209 5 0 214 6 0 6 2 14 13 198 0 0 211 0 0 0 0 0 439 04:00 PM 0 63 1 0 64 0 0 2 0 2 2 51 0 0 53 0 0 0 0 0 119 04:15 PM 0 43 1 0 44 3 0 2 0 5 2 63 0 0 65 0 0 0 0 0 114 04:30 PM 0 35 1 0 36 0 0 2 0 2 2 58 0 0 60 0 0 0 0 0 98 04:45 PM 0 41 3 0 44 1 0 5 0 6 2 52 0 0 54 0 0 0 0 0 104 Total 0 182 6 0 188 4 0 11 0 15 8 224 0 0 232 0 0 0 0 0 435 05:00 PM 0 47 0 0 47 0 0 1 0 1 4 65 0 0 69 0 0 0 0 0 117 05:15 PM 0 35 1 0 36 3 0 4 0 7 2 53 0 0 55 0 0 0 0 0 98 05:30 PM 0 40 1 0 41 1 0 2 0 3 1 49 0 0 50 0 0 0 0 0 94 05:45 PM 0 41 0 0 41 0 0 5 0 5 2 43 0 0 45 0 0 0 0 0 91 Total 0 163 2 0 165 4 0 12 0 16 9 210 0 0 219 0 0 0 0 0 400 06:00 PM 0 24 0 0 24 0 0 1 0 1 3 32 0 0 35 0 0 0 0 0 60 06:15 PM 0 28 0 0 28 1 0 3 0 4 5 30 0 0 35 0 0 0 0 0 67 06:30 PM 0 21 0 0 21 0 0 2 1 3 2 24 0 0 26 0 0 0 0 0 50 06:45 PM 0 23 0 0 23 2 0 1 0 3 3 20 0 0 23 0 0 0 0 0 49 Total 0 96 0 0 96 3 0 7 1 11 13 106 0 0 119 0 0 0 0 0 226 07:00 PM 0 17 0 0 17 0 0 1 0 1 0 14 0 0 14 0 0 0 0 0 32 07:15 PM 0 20 0 0 20 0 0 7 0 7 0 17 0 2 19 0 0 0 0 0 46 07:30 PM 0 12 0 0 12 0 0 0 0 0 4 18 0 0 22 0 0 0 0 0 34 07:45 PM 0 12 0 0 12 0 0 1 0 1 1 25 0 1 27 0 0 0 0 0 40 Total 0 61 0 0 61 0 0 9 0 9 5 74 0 3 82 0 0 0 0 0 152 08:00 PM 0 21 0 0 21 0 0 1 0 1 3 16 0 2 21 0 0 0 0 0 43 08:15 PM 0 13 0 0 13 0 0 0 0 0 1 21 0 0 22 0 0 0 0 0 35 08:30 PM 0 11 1 0 12 0 0 0 0 0 1 15 0 1 17 0 0 0 0 0 29 08:45 PM 0 17 1 0 18 0 0 1 0 1 1 9 0 0 10 0 0 0 0 0 29 Total 0 62 2 0 64 0 0 2 0 2 6 61 0 3 70 0 0 0 0 0 136 Bolton & Menici nc Turning Movement Counts File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 Grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 4 Start Time Right From North Thru Left Peds From East From South Right Thru Left Peds From West Int. Total App. Total Right Thru Left Peds App. Total App. Total Right Thru Left Peds App. Total 09:00 PM 0 8 0 0 8 0 0 0 0 0 2 17 0 0 19 0 0 0 0 0 27 09:15 PM 0 5 0 0 5 0 0 0 0 0 1 14 0 0 15 0 0 0 0 0 20 09:30 PM 0 3 0 0 3 0 0 0 0 0 1 4 0 0 5 0 0 0 0 0 8 09:45 PM 0 7 0 0 7 1 0 0 0 1 1 4 0 0 5 0 0 0 0 0 13 Total 0 23 0 0 23 1 0 0 0 1 5 39 0 0 44 0 0 0 0 0 68 10:00 PM 0 0 0 0 0 0 0 0 0 0 1 7 0 0 8 0 0 0 0 0 8 10:15 PM 0 2 0 0 2 0 0 0 0 0 1 6 0 0 7 0 0 0 0 0 9 10:30 PM 0 2 0 0 2 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 5 10:45 PM 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 Total 0 4 0 0 4 0 0 0 0 0 2 17 0 0 19 0 0 0 0 0 23 11:00 PM 0 3 0 0 3 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 5 11:15 PM 0 0 0 0 0 0 0 0 0 0 1 2 0 0 3 0 0 0 0 0 3 11:30 PM 0 4 0 0 4 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 5 11:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 7 0 0 7 0 0 0 0 0 1 5 0 0 6 0 0 0 0 0 13 Grand Total 0 1893 42 0 1935 44 0 111 36 191 117 2061 0 95 2273 0 0 0 0 0 4399 Apprch % 0 97.8 2.2 0 23 0 58.1 18.8 5.1 90.7 0 4.2 0 0 0 0 Total % 0 43 1 0 44 1 0 2.5 0.8 4.3 2.7 46.9 0 2.2 51.7 0 0 0 0 Cars + 0 1839 38 0 1877 42 0 107 34 183 115 1994 0 94 2203 0 0 0 0 0 4263 % Cars + 0 97.1 90.5 0 97 95.5 0 96.4 94.4 95.8 98.3 96.7 0 98.9 96.9 0 0 0 0 0 96.9 Trucks 0 54 4 0 58 2 0 4 2 8 2 67 0 1 70 0 0 0 0 0 136 % Trucks 0 2.9 9.5 0 3 4.5 0 3.6 5.6 4.2 1.7 3.3 0 1.1 3.1 0 0 0 0 0 3.1 Groups Printed- Cars + - Trucks 00 0 00 co O North 0 Out 2036 69 2105 In 1877 58 _735 Total 3913 127 _4040 O 1839 38 O 54 4 0 1893 42 0 Right Thru Left Peds 0 0 3/29/204 12:00 AM 3/29/2022 11:45 PM Cars + Trucks 4-- o o o " A V 0_ a CD a) — co Cc) co 9_ co al A 0) — 00 00 0 0 co 0 a) CD .1c). 0 00 a 0 0 0 0 00 O Left Thru Right Peds O 1994 115 94 0 67 2 1 0 2061 117 95 1946 22031 41491 58 70 128 2004 2273 4277J Out In Total Bolton & Menkr I nc Turning Movement Counts Grove St and Tracy Ave Edina, MN File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 Start Date : 3/29/2022 Page No : 5 Bolton & Menkr I nc Turning Movement Counts File Name : tracy and countryside 24 hr 2022-03-29 Site Code : 00000000 grove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 6 Start Time Peak Hour Analysis Peak Hour for Entire From North Right Thru Left Peds From 12:00 AM to 12:00 PM - Peak Intersection Begins at 07:15 AM From East Right Thru From South Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total App. Total 1 of 1 Right Thru Left Peds App. Total 07:15 AM 0 27 0 27 1 0 1 1 3 0 54 0 2 56 0 0 0 0 0 86 07:30 AM 0 70 4 0 74 3 0 0 5 8 7 69 0 32 108 0 0 0 0 0 190 07:45 AM 0 107 3 0 110 2 0 5 2 9 3 42 0 2 47 0 0 0 0 0 166 08:00 AM 0 41 2 0 43 2 0 7 0 9 3 34 0 0 37 0 0 0 0 0 89 Total Volume 0 245 9 254 8 0 13 8 29 13 199 0 36 248 0 0 0 0 0 531 % App. Total 0 96.5 3.5 0 27.6 0 44.8 27.6 5.2 80.2 0 14.5 0 0 0 0 PHF .000 .572 .563 .000 .577 .667 .000 .464 .400 .806 .464 .721 .000 .281 .574 .000 .000 .000 .000 .000 .699 Cars + 0 237 7 0 244 8 0 13 8 29 13 189 0 36 238 0 0 0 0 0 511 Cars + 96.7 77.8 0 96.1 100 0 100 100 100 100 95.0 0 100 96.0 0 0 0 0 0 96.2 Trucks 0 0 8 2 10 0 0 0 0 0 0 10 0 0 10 0 0 0 0 0 20 % Trucks 3.3 22.2 0 3.9 0 0 0 0 0 0 5.0 0 0 4.0 0 0 0 0 0 3.8 Peak Hour Analysis From 12:15 PM to 11:45 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 03:30 PM 03:30 PM 0 59 4 0 63 1 0 1 0 2 7 57 0 0 64 0 0 0 0 0 129 03:45 PM 0 72 0 0 72 1 0 3 0 4 3 57 0 0 60 0 0 0 0 0 136 04:00 PM 0 63 1 0 64 0 0 2 0 2 2 51 0 0 53 0 0 0 0 0 119 04:15 PM 0 43 1 0 44 3 0 2 0 5 2 63 0 0 65 0 0 0 0 0 114 Total Volume 0 237 6 0 243 5 0 8 0 13 14 228 0 0 242 0 0 0 0 0 498 % App. Total 0 97.5 2.5 38.5 0 61.5 0 5.8 94.2 0 0 o o 0 0 PHF .000 .823 .375 .000 .844 .417 .000 .667 .000 .650 .500 .905 .000 .000 .931 .000 .000 .000 .000 .000 .915 Cars + 0 223 5 0 228 4 0 8 0 12 14 219 0 0 233 0 0 0 0 0 473 % Cars + 0 94.1 83.3 0 93.8 80.0 0 100 0 92.3 100 96.1 0 0 96.3 0 0 0 0 0 95.0 Trucks 0 14 1 0 15 1 0 0 0 1 0 9 0 0 9 0 0 0 0 0 25 % Trucks 0 5.9 16.7 0 6.2 20.0 0 0 0 7.7 0 3.9 0 0 3.7 0 0 0 0 0 5.0 Bolton & Meniki I nc Turning Movement Counts File Name : Stuart & Grove 24 hr 2022-03-29 Site Code :00000000 3 rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No :1 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 _ 12:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 1 0 0 1 2 03:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 1 0 0 1 2 04:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 05:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 06:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 06:15 AM 0 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 0 0 0 2 06:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 06:45 AM 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 0 0 0 0 5 Total 0 0 0 0 0 0 6 0 0 6 1 0 0 0 1 0 1 0 0 1 8 Bolton & Menkr I tic Turning Movement Counts File Name : Stuart & Grove 24 hr 2022-03-29 Site Code : 00000000 3 rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 2 Groups Printed- Cars + - Trucks Start Time Right Thru From North Left Peds From East Right Thru From South Left Peds From West Int. Total App. Total Right Thru Left Peds App. Total App. Total Right Thru Left Peds App. Total 07:00 AM 0 0 0 0 0 0 0 2 0 2 0 0 0 0 0 1 6 0 0 7 9 07:15 AM 0 0 0 0 0 0 2 9 0 11 0 0 1 1 2 1 5 0 0 6 19 07:30 AM 0 0 0 0 0 0 4 46 0 50 2 0 0 0 2 27 6 0 5 38 90 07:45 AM 0 0 0 0 0 0 6 6 0 12 3 0 4 1 8 7 10 0 5 22 42 Total 0 0 0 0 0 0 12 63 0 75 5 0 5 2 12 36 27 0 10 73 160 08:00 AM 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 0 2 0 0 2 6 08:15 AM 0 0 0 0 0 0 3 0 0 3 0 0 1 0 1 0 6 0 0 6 10 08:30 AM 0 0 0 0 0 0 6 0 0 6 1 0 0 0 1 0 3 0 0 3 10 08:45 AM 0 0 0 0 0 0 2 1 0 3 1 0 0 0 1 0 7 0 0 7 11 Total 0 0 0 0 0 0 15 1 0 16 2 0 1 0 3 0 18 0 0 18 37 09:00 AM 0 0 0 0 0 0 2 1 0 3 0 0 0 0 0 1 9 0 0 10 13 09:15 AM 0 0 0 0 0 0 5 0 0 5 0 0 1 0 1 0 2 0 0 2 8 09:30 AM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 2 09:45 AM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 0 3 0 0 3 6 Total 0 0 0 0 0 0 11 1 0 12 0 0 1 0 1 1 15 0 0 16 29 10:00 AM 0 0 0 0 0 0 1 0 0 1 0 0 3 0 3 0 2 0 0 2 6 10:15 AM 0 0 0 0 0 0 1 0 0 1 0 0 1 0 1 1 3 0 0 4 6 10:30 AM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 1 4 0 0 5 6 10:45 AM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 0 6 0 0 6 9 Total 0 0 0 0 0 0 6 0 0 6 0 0 4 0 4 2 15 0 0 17 27 11:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 3 0 0 3 4 11:15 AM 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 0 5 0 0 5 9 11:30 AM 0 0 0 0 0 0 2 0 0 2 0 0 1 0 1 0 2 0 0 2 5 11:45 AM 0 0 0 0 0 0 4 0 0 4 1 0 2 0 3 3 2 0 0 5 12 Total 0 0 0 0 0 0 10 0 0 10 1 0 4 0 5 3 12 0 0 15 30 12:00 PM 0 0 0 0 0 0 2 0 0 2 0 0 1 0 1 0 0 0 0 0 3 12:15 PM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 0 3 0 0 3 6 12:30 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 1 1 1 1 0 0 2 5 12:45 PM 0 0 0 0 0 0 7 0 0 7 0 0 1 0 1 0 4 0 0 4 12 Total 0 0 0 0 0 0 14 0 0 14 0 0 2 1 3 1 8 0 0 9 26 01:00 PM 0 0 0 0 0 0 5 0 0 5 1 0 0 0 1 1 8 0 0 9 15 01:15 PM 0 0 0 0 0 0 2 0 0 2 0 0 2 0 2 3 2 0 1 6 10 01:30 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 2 2 01:45 PM 0 0 0 0 0 0 4 5 1 10 0 0 1 1 2 2 2 0 0 4 16 Total 0 0 0 0 0 0 11 5 1 17 1 0 3 1 5 6 13 0 2 21 43 Bolton & Menky tic Turning Movement Counts File Name : Stuart & Grove 24 hr 2022-03-29 Site Code : 00000000 3rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 3 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 02:00 PM 0 0 0 0 0 0 3 14 0 17 0 0 0 0 0 2 3 0 0 5 22 02:15 PM 0 0 0 0 0 0 3 12 0 15 1 0 1 0 2 2 6 0 0 8 25 02:30 PM 0 0 0 0 0 0 7 0 0 7 2 0 7 0 9 2 6 0 4 12 28 02:45 PM 0 0 0 0 0 0 3 0 0 3 1 0 1 0 2 0 5 0 0 5 10 Total 0 0 0 0 0 0 16 26 0 42 4 0 9 0 13 6 20 0 4 30 85 03:00 PM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 1 4 0 0 5 8 03:15 PM 0 0 0 0 0 0 8 0 0 8 0 0 1 0 1 2 2 0 0 4 13 03:30 PM 0 0 0 0 0 0 4 3 0 7 1 0 3 0 4 2 5 0 0 7 18 03:45 PM 0 0 0 0 0 0 3 0 0 3 0 0 2 0 2 0 2 0 0 2 7 Total 0 0 0 0 0 0 18 3 0 21 1 0 6 0 7 5 13 0 0 18 46 04:00 PM 0 0 0 0 0 0 3 0 0 3 0 0 1 0 1 0 3 0 0 3 7 04:15 PM 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 2 10 0 2 14 19 04:30 PM 0 0 0 0 0 0 3 2 0 5 0 0 2 0 2 2 4 0 0 6 13 04:45 PM 0 0 0 0 0 0 6 0 0 6 0 0 3 2 5 5 3 0 0 8 19 Total 0 0 0 0 0 0 17 2 0 19 0 0 6 2 8 9 20 0 2 31 58 05:00 PM 0 0 0 0 0 0 3 0 0 3 1 0 5 0 6 3 4 0 0 7 16 05:15 PM 0 0 0 0 0 0 2 1 0 3 1 0 3 0 4 0 5 0 0 5 12 05:30 PM 0 0 0 0 0 0 7 0 0 7 0 0 2 2 4 0 5 0 0 5 16 05:45 PM 0 0 0 0 0 0 8 0 0 8 0 0 1 0 1 1 3 0 0 4 13 Total 0 0 0 0 0 0 20 1 0 21 2 0 11 2 15 4 17 0 0 21 57 06:00 PM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 1 3 0 0 4 7 06:15 PM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 0 6 0 0 6 9 06:30 PM 0 0 0 0 0 0 2 0 0 2 0 0 1 0 1 0 2 0 0 2 5 06:45 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 2 1 0 0 3 5 Total 0 0 0 0 0 0 10 0 0 10 0 0 1 0 1 3 12 0 0 15 26 07:00 PM 0 0 0 0 0 0 4 1 0 5 0 0 1 0 1 0 4 0 0 4 10 07:15 PM 0 0 0 0 0 0 3 0 0 3 1 0 0 0 1 0 1 0 0 1 5 07:30 PM 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 0 0 0 0 1 07:45 PM 0 0 0 0 0 0 5 0 0 5 0 0 0 0 0 0 1 0 2 3 8 Total 0 0 0 0 0 0 12 2 0 14 1 0 1 0 2 0 6 0 2 8 24 08:00 PM 0 0 0 0 0 0 3 0 0 3 0 0 1 0 1 0 7 0 0 7 11 08:15 PM 0 0 0 0 0 0 4 0 0 4 0 0 1 0 1 0 1 0 0 1 6 08:30 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 08:45 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 2 Total 0 0 0 0 0 0 8 0 0 8 0 0 2 0 2 0 9 0 0 9 19 Bolton & Menkr nc Turning Movement Counts File Name : Stuart & Grove 24 hr 2022-03-29 Site Code : 00000000 3rove St and Tracy Ave Start Date : 3/29/2022 Edina, MN Page No : 4 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 09:00 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 0 2 0 0 2 4 09:15 PM 0 0 0 0 0 0 3 0 0 3 0 0 0 0 0 1 0 0 0 1 4 09:30 PM 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 0 1 0 0 1 5 09:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 9 0 0 9 0 0 0 0 0 1 3 0 0 4 13 10:00 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 10:15 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 0 1 0 0 1 3 10:30 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 10:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 4 0 0 4 0 0 0 0 0 0 1 0 0 1 5 11:00 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11:15 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 11:30 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 11:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 Grand Total 0 0 0 0 0 0 200 104 1 305 19 0 56 8 83 77 212 0 20 309 697 Apprch % 0 0 0 0 0 65.6 34.1 0.3 22.9 0 67.5 9.6 24.9 68.6 0 6.5 Total % 0 0 0 0 0 28.7 14.9 0.1 43.8 2.7 0 8 1.1 11.9 11 30.4 0 2.9 44.3 Cars + 0 0 0 0 0 0 197 84 1 282 18 0 53 8 79 69 208 0 19 296 657 cY0 Cars + 0 0 0 0 0 0 98.5 80.8 100 92.5 94.7 0 94.6 100 95.2 89.6 98.1 0 95 95.8 94.3 Trucks 0 0 0 0 0 0 3 20 0 23 1 0 3 0 4 8 4 0 1 13 40 % Trucks 0 0 0 0 0 0 1.5 19.2 0 7.5 5.3 0 5.4 0 4.8 10.4 1.9 0 5 4.2 5.7 3enton Ave and East School Entrance Edina, MN Bolton & Menkr I nc Turning Movement Counts File Name Site Code Start Date Page No : Benton and East Entrance 24 hr 2022-03-29 :00000000 : 3/29/2022 :1 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 12:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 12:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 o 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 01:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:00 AM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 02:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 02:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 02:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 2 03:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 03:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 04:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 AM __04:45 0 0 0 o 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:00 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 05:45 AM 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 2 0 0 2 3 Total 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 0 2 0 0 2 3 06:00 AM 0 0 0 0 0 0 0 2 0 2 0 0 0 0 0 0 0 0 0 0 2 06:15 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 06:30 AM 0 0 0 0 0 0 0 5 0 5 0 0 0 0 0 0 0 0 0 0 5 06:45 AM 0 0 0 0 0 0 0 9 0 9 1 0 0 0 1 0 0 0 0 0 10 Total 0 0 0 0 0 0 0 16 0 16 1 0 0 0 1 0 0 0 0 0 17 Benton Ave and East School Entrance Edina, MN Bolton & MenKr I nc Turning Movement Counts File Name Site Code Start Date Page No : Benton and East Entrance 24 hr 2022-03-29 :00000000 : 3/29/2022 :2 Groups Printed- Cars + - Trucks Start Time Right From North Thru Left _ Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:00 AM 0 0 0 0 0 0 4 20 0 24 1 0 0 0 1 1 0 0 0 1 26 07:15 AM 0 0 0 0 0 0 1 33 0 34 2 0 0 0 2 1 6 0 0 7 43 07:30 AM 0 0 0 0 0 0 14 36 0 50 49 0 1 0 50 0 34 0 0 34 134 07:45 AM 0_ 0 0 0 0 0 16 5 0 21 47 0 6 0 53 0 21 0 0 21 95 Total 0 0 0 0 0 0 35 94 0 129 99 0 7 0 106 2 61 0 0 63 298 08:00 AM 0 0 0 0 0 0 3 1 0 4 1 0 0 0 1 0 1 0 0 1 6 08:15 AM 0 0 0 0 0 0 4 1 0 5 0 0 0 0 0 0 1 0 0 1 6 08:30 AM 0 0 0 0 0 0 1 0 0 1 1 0 1 0 2 0 0 0 0 0 3 08:45 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 1 1 Total 0 0 0 0 0 0 8 2 0 10 2 0 1 0 3 0 3 0 0 3 16 09:00 AM 0 0 0 0 0 0 3 1 0 4 3 0 0 0 3 0 1 0 0 1 8 09:15 AM 0 0 0 0 0 0 4 3 1 8 3 0 1 0 4 0 1 0 0 1 13 09:30 AM 0 0 0 0 0 0 2 1 0 3 1 0 0 0 1 0 2 0 0 2 6 09:45 AM 0 0 0 0 0 0 2 2 0 4 4 0 0 0 4 0 1 0 0 1 9 Total 0 0 0 0 0 0 11 7 1 19 11 0 1 0 12 0 5 0 0 5 36 10:00 AM 0 0 0 0 0 0 5 1 0 6 1 0 1 0 2 0 0 0 0 0 8 10:15 AM 0 0 0 0 0 0 2 0 0 2 3 0 0 0 3 0 1 0 0 1 6 10:30 AM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3 0 0 3 3 10:45 AM 0 0 0 0 0 0 2 1 0 3 2 0 0 0 2 0 0 0 0 0 5 Total 0 0 0 0 0 0 9 2 0 11 6 0 1 0 7 0 4 0 0 4 22 11:00 AM 0 0 0 0 0 0 2 0 0 2 1 0 0 0 1 0 0 0 0 0 3 11:15 AM 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 0 0 0 0 0 1 11:30 AM 0 0 0 0 0 0 2 1 0 3 4 0 0 0 4 0 0 0 0 0 7 11:45 AM 0 0 0 0 0 0 2 1 0 3 0 0 0 0 0 0 4 0 0 4 7 Total 0 0 0 0 0 0 6 2 0 8 6 0 0 0 6 0 4 0 0 4 18 12:00 PM 0 0 0 0 0 0 1 1 0 2 1 0 0 0 1 0 0 0 0 0 3 12:15 PM 0 0 0 0 0 0 2 0 0 2 2 0 0 0 2 0 1 0 0 1 5 12:30 PM 0 0 0 0 0 0 1 2 0 3 6 0 0 0 6 0 1 0 0 1 10 12:45 PM 0 0 0 0 0 0 2 0 0 2 4 0 0 _ 0 4 0 1 0 0 1 7 Total 0 0 0 0 0 0 6 3 0 9 13 0 0 0 13 0 3 0 0 3 25 01:00 PM 0 0 0 0 0 0 4 3 0 7 2 0 0 0 2 0 1 0 0 1 10 01:15 PM 0 0 0 0 0 0 3 2 0 5 2 0 0 1 3 0 0 0 0 0 8 01:30 PM 0 0 0 0 0 0 3 5 0 8 2 0 0 1 3 0 1 0 0 1 12 01:45 PM 0 0 0 0 0 0 6 7 0 13 1 0 0 1 2 1 0 0 0 1 16 Total 0 0 0 0 0 0 16 17 0 33 7 0 0 3 10 1 2 0 0 3 46 3enton Ave and East School Entrance Edina, MN Bolton & MenKr nc Turning Movement Counts File Name Site Code Start Date Page No : Benton and East Entrance 24 hr 2022-03-29 :00000000 : 3/29/2022 :3 Groups Printed- Cars + - Trucks Start Time Right From North Thru _ Left Peds App. Total Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 02:00 PM 0 0 0 0 0 0 9 8 0 17 5 0 1 2 8 0 2 0 0 2 27 02:15 PM 0 0 0 0 0 0 2 15 0 17 20 0 2 0 22 0 16 0 1 17 56 02:30 PM 0 0 0 0 0 0 3 3 0 6 36 0 7 0 43 0 6 0 0 6 55 02:45 PM 0 0 0 0 0 0 1 0 0 1 7 0 1 1 9 0 0 0 0 0 10 Total 0 0 0 0 0 0 15 26 0 41 68 0 11 3 82 0 24 0 1 25 148 03:00 PM 0 0 0 0 0 0 1 1 0 2 4 0 0 0 4 0 1 0 0 1 7 03:15 PM 0 0 0 0 0 0 8 8 0 16 10 0 1 1 12 2 0 0 0 2 30 03:30 PM 0 0 0 0 0 0 6 4 0 10 35 0 2 1 38 0 3 0 0 3 51 03:45 PM _ 0_ 0 0 0 0 0 1 2 0 3 8 0 2 0 10 0 1 0 1 2 15 Total 0 0 0 0 0 0 16 15 0 31 57 0 5 2 64 2 5 0 1 8 103 04:00 PM 0 0 0 0 0 0 11 0 0 11 11 0 2 0 13 1 0 0 0 1 25 04:15 PM 0 0 0 0 0 0 8 1 0 9 13 0 0 0 13 0 1 0 0 1 23 04:30 PM 0 0 0 0 0 0 16 1 0 17 18 0 2 0 20 1 1 0 0 2 39 04:45 PM 0 0 0 0 0 0 15 0 0 15 22 0 3 0 25 0 0 0 0 0 40 Total 0 0 0 0 0 0 50 2 0 52 64 0 7 0 71 2 2 0 0 4 127 05:00 PM 0 0 0 0 0 0 12 0 0 12 22 0 3 0 25 0 0 0 0 0 37 05:15 PM 0 0 0 0 0 0 9 0 0 9 9 0 0 0 9 0 2 0 0 2 20 05:30 PM 0 0 0 0 0 0 9 1 0 10 8 0 0 0 8 0 1 0 0 1 19 05:45 PM 0 0 0 0 0 0 3 2 0 5 12 0 0 0 12 0 1 0 0 1 18 Total 0 0 0 0 0 0 33 3 0 36 51 0 3 0 54 0 4 0 0 4 94 06:00 PM 0 0 0 0 0 0 0 0 0 0 1 0 1 0 2 0 0 0 0 0 2 06:15 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 1 1 06:30 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 06:45 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 3 0 0 3 4 Total 0 0 0 0 0 0 2 0 0 2 1 0 1 0 2 1 3 0 0 4 8 07:00 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 0 0 0 0 0 2 07:15 PM 0 0 0 0 0 0 1 0 0 1 1 0 0 0 1 0 0 0 0 0 2 07:30 PM 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 07:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 1 0 0 0 1 2 Total 0 0 0 0 0 0 3 0 0 3 1 0 1 0 2 1 0 0 0 1 6 08:00 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 1 0 0 1 2 08:15 PM 0 0 0 0 0 0 1 0 0 1 0 0 0 0 0 0 0 0 0 0 1 08:30 PM 0 0 0 0 0 0 2 0 0 2 0 0 0 0 0 0 0 0 0 0 2 08:45 PM 0 0 0 0 0 0 0 0 0 0 0 0 1 0 1 0 0 0 0 0 1 Total 0 0 0 0 0 0 4 0 0 4 0 0 1 0 1 0 1 0 0 1 6 App. Total 1 0 0 0 1 Int. Total 1 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 1 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 939 95.8 41 4.2 2 1.5 0.2 2 100 0 0 0 0 0 0 0 0 0 124 90.5 12.7 120 96.8 4 3.2 8 1.8 0.8 7 87.5 1 12.5 40 9.2 4.1 38 95 2 5 0 0 0 0 0 0 0 1 0.2 0.1 1 100 0 0 215 53 21.9 209 97.2 6 2.8 190 46.8 19.4 189 99.5 1 0.5 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 10:00 PM 10:15 PM 10:30 PM 10:45 PM Total 11:00 PM 11:15 PM 11:30 PM 11:45 PM Total Grand Total Apprch Total % Cars + % Cars + Trucks % Trucks 2 0 2 0 4 0 0 0 0 0 137 980 14 133 97.1 4 2.9 1 0 2 0 3 0 0 0 0 0 437 11 8 44.6 1.1 407 11 93.1 100 30 0 6.9 0 0 2 0 2 0 0 0 0 0 406 389 89 41.4 39.7 399 362 98.3 93.1 7 27 1.7 6.9 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 3enton Ave and East School Entrance Edina, MN Bolton & Menkr nc Turning Movement Counts File Name Site Code Start Date Page No : Benton and East Entrance 24 hr 2022-03-29 :00000000 : 3/29/2022 :4 Groups Printed- Cars + - Trucks From North Thru_ Left Peds 0 0 0 0 0 0 0 0 0 0 0 0 0 0 From East App. Total Right Thru Left Peds App. Total Right 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 o 0 0 0 0 o 0 0 0 0 0 0 0 0 From South Thru Left Peds 0 0 0 0 0 0 0 0 0 0 0 0 0 0 From West Left Peds 0 0 0 0 0 0 0 0 0 0 Start Time Right 09:00 PM 0 09:15 PM 0 09:30 PM 0 09:45 PM 0 Total 0 App. Total Right Thru 0 1 0 0 0 0 0 0 0 0 0 0 0 1 0 Out InIn Total 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 Right Thru Left Peds 4 0 0 — — CO -J CD .7.. 0 0 0 COCO 0 o 7,- ,r North ,4- f- 1, N., . — N m- N 2 H 1- = 4 .... H 3/29/2022 12:00 AM 2 (71 cn 3 ,— 3/29/2022 11:45 PM .0. ,— 0 CD .-t Trucks ... — CD CO 0 -.. CD 0) -4 CD 0) l T. r.... CO LO E , Cars + 5 nt ,I) N 0 N . H 0 " " -0 -0 CO Ct) 9. cp a) N _. p — c), co a) 0_ COW — — 4 Left Thru Right Peds 38 0 362 7 2 0 27 1 40 0 389 8 200 407 607 1 30 31 201 437 638 Out In Total Bolton & Menkr I nc Turning Movement Counts File Name : Benton and East Entrance 24 hr 2022-03-29 Site Code : 00000000 Benton Ave and East School Entrance Start Date : 3/29/2022 Edina, MN Page No : 5 3enton Ave and East School Entrance Edina, MN Bolton & Menkr I nc Turning Movement Counts File Name Site Code Start Date Page No : Benton and East Entrance 24 hr 2022-03-29 :00000000 : 3/29/2022 :6 From North Start Time Right Thru Left Peds App. Total Peak Hour Analysis From 12:00 AM to 12:00 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 07:00 AM Right From East Thru Left Peds App. Total Right From South Thru Left Peds App. Total Right From West Thru Left Peds App. Total Int. Total 07:00 AM 0 0 0 0 0 0 4 20 0 24 1 0 0 0 1 1 0 0 0 1 26 07:15 AM 0 0 0 0 0 0 1 33 0 34 2 0 0 0 2 1 6 0 0 7 43 07:30 AM 0 0 0 0 0 0 14 36 0 50 49 0 1 0 50 0 34 0 0 34 134 07:45 AM 0 0 0 0 0 0 16 5 0 21 47 0 6 0 53 0 21 0 0 21 95 Total Volume 0 0 0 0 0 0 35 94 0 129 99 0 7 0 106 2 61 0 0 63 298 % App. Total 0 0 0 0 0 27.1 72.9 0 93.4 0 6.6 0 3.2 96.8 0 0 PHF .000 .000 .000 .000 .000 .000 .547 .653 .000 .645 .505 .000 .292 .000 .500 .500 .449 .000 .000 .463 .556 Cars + 0 0 0 0 0 0 35 94 0 129 85 0 7 0 92 2 61 0 0 63 284 % Cars + 0 0 0 0 0 0 100 100 0 100 85.9 0 100 0 86.8 100 100 0 0 100 95.3 Trucks 0 0 0 0 0 0 0 0 0 0 14 0 0 0 14 0 0 0 0 0 14 % Trucks 0 0 0 0 0 0 0 0 0 0 14.1 0 0 0 13.2 0 0 0 0 0 4.7 Peak Hour Analysis From 12:15 PM to 11:45 PM - Peak 1 of 1 Peak Hour for Entire Intersection Begins at 01:45 PM 01:45 PM 0 0 0 0 0 0 6 7 0 13 1 0 0 1 2 1 0 0 0 1 16 02:00 PM 0 0 0 0 0 0 9 8 0 17 5 0 1 2 8 0 2 0 0 2 27 02:15 PM 0 0 0 0 0 0 2 15 0 17 20 0 2 0 22 0 16 0 1 17 56 02:30 PM 0 0 0 0 0 0 3 3 0 6 36 0 7 0 43 0 6 0 0 6 55 Total Volume 0 0 0 0 0 0 20 33 0 53 62 0 10 3 75 1 24 0 1 26 154 % App. Total 0 0 0 0 0 37.7 62.3 0 82.7 0 13.3 4 3.8 92.3 0 3.8 PHF .000 .000 .000 .000 .000 .000 .556 .550 .000 .779 .431 .000 .357 .375 .436 .250 .375 .000 .250 .382 .688 Cars + 0 0 0 0 0 0 16 33 0 49 50 0 8 3 61 1 22 0 1 24 134 % Cars + 0 0 0 0 0 0 80.0 100 0 92.5 80.6 0 80.0 100 81.3 100 91.7 0 100 92.3 87.0 Trucks 0 0 0 0 0 0 4 0 0 4 12 0 2 0 14 0 2 0 0 2 20 % Trucks 0 0 0 0 0 0 20.0 0 0 7.5 19.4 0 20.0 0 18.7 0 8.3 0 0 7.7 13.0 Appendix B: Green Sheet Intersection Safety Screening Intersection: Tracy Ave and Benton Ave Statewide Averages based on 2016-2020 crashes Crashes by Crash Severity Intersection Characteristics Fatal (K) 0 Entering Volume 2,225 Serious Injury (A) 0 Environment Urban Minor Injury (B) 0 Lighting Lit Possible Injury (C) 0 Traffic Control All-way Stop Property Damage (PDO) 2 Total Crashes 2 Annual crash cost = $5,200 Statewide comparison = All-way STOP Total Crash Rate Fatal & Serious Injury Crash Rate Observed 0.492 Observed 0.000 Statewide Average 0.267 Statewide Average 0.221 Critical Rate 1.050 Critical Rate 15.510 Critical Index 0.47 Critical Index 0.00 The observed crash rate is the number of crashes per million entering vehicles (MEV). The critical rate is a statistical comparison based on similar intersections statewide. An observed crash rate greater than the critical rate indicates that the intersection operates outside the expected, normal range. The critical index reports the magnitude of this difference (i.e. observed crash rate ÷ critical crash rate). The observed total crash rate for this period is 0.49 per MEV; this is 53% below the critical rate. Based on similar statewide intersections, an additional 3 crashes over the five years would indicate this intersection operates outside the normal range. The observed fatal and serious injury crash rate for this period is 0.00 per 100 MEV; this is 100% below the critical rate. The intersection operates within the normal range. Developed by MnDOT Office of Traffic Engineering. January 2022. The CITY ofEDINA Conditional Use Permit –Edina Public Schools (Countryside) The CITY ofEDINA EdinaMN.gov 2 The CITY ofEDINA EdinaMN.gov 3 The CITY ofEDINA EdinaMN.gov 4 The CITY ofEDINA EdinaMN.gov 5 The CITY ofEDINA EdinaMN.gov 6 The CITY ofEDINA EdinaMN.gov 7 The CITY ofEDINA EdinaMN.gov 8 The CITY ofEDINA EdinaMN.gov 9 City Standard Proposed Front/parking – Benton Avenue Side Street/parking – Tracy Ave. Side Street/parking – Stuart Ave. Side – South/building Side – West/building Front – North/building Front – East/building 20 feet 20 feet 20 feet 50 feet 50 feet 50 feet 50 feet 20 feet (existing) 38 feet 20 feet (existing) 100+ feet (existing) 100+ feet (existing) 57 feet (existing) 140 feet Parking Stalls 78 126 The CITY ofEDINA EdinaMN.gov 10 The CITY ofEDINAPrimary Issue Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 11 1. The Conditional Use Permit criteria is met. a) Does not have an undue adverse impact on governmental facilities, utilities, services or existing or proposed improvements. b) Will generate traffic within the capacity of the streets serving the property. c) Does not have an undue adverse impact on the public health, safety, or welfare. d) Will not impede the normal and orderly development and improvement of other property in the vicinity. e) Conforms to the applicable restrictions and special conditions of the district in which it is located as imposed by this Section; and f) is consistent with the Comprehensive Plan. The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 12 2. The proposal meets all minimum Zoning Ordinance standards. All setback requirements and lighting standards would be met. 3. The proposal would improve traffic and circulation on the site. The number of parking stalls remains in compliance the Zoning Ordinance. The new driveway would only be for buses and staff. Parent drop-offs would continue off Benton Avenue. Staff and buses will be able to enter and exit from both Tracy Ave and Countryside Rd. Engineering staff has reviewed the left-hand turn movements on Tracy Avenue and feel there would be adequate sight lines. Staff believes the timing of student crossings compared to staff entering and exiting the site will be different and thus not create additional issues for crossing of Tracy. If the project is implemented, city staff can monitor the number of crossings of Tracy at the crosswalk to determine if pedestrian flashers are warranted to add extra notification of crossings. Staff believes there is adequate sight lines of the crosswalk today. The project would not change those sightlines. The school may also consider crossing guards to assist with crossings. The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 13 4. The plan includes landscaping and trees planted along Tracy Avenue and around the re- located maintenance building to provide partial screening. Staff does recommend additional plantings along Tracy and Benton to provide additional screening of the parking lot. The CITY ofEDINAStaff Recommendation EdinaMN.gov 14 Motion to close the public hearing at noon on July 25, 2022, and continue action to the August 3 City Council meeting. The CITY ofEDINAStaff & PC Recommendation EdinaMN.gov 16 Recommend that the City Council approve the Conditional Use Permit to expand the parking area for Countryside School at 5701 Benton Avenue. Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. The CITY ofEDINAStaff & PC Recommendation EdinaMN.gov 17 Approval is subject to the following conditions: 1. The site must be developed and maintained in conformance with the following plans: • Site plan date stamped May 22, 2022. • Plan modifications dated May 27, 2022. • Lighting photometric May 22, 2022. • Grading and drainage plan date stamped May 22, 2022. • Landscaping plan date stamped May 22, 2022 • Geometric plan date stamped May 22, 2022 • Utility and erosion control plan date stamped May 22, 2022. 2. A building and grading permit is required for the improvements. 3. A lighting plan, landscape plan and grading plan must be submitted, and meet all minimum zoning ordinance requirements. 4. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. 5. Additional evergreens along Benton and Tracy must be planted to fill in the gaps of existing and proposed landscaping to provide better screening of the parking lots for residents across the street from the school. Final Landscape Plan and additional screening is subject to review and approval of the city forester prior to issuance of a building permit. Survey Responses 30 January 2019 - 25 July 2022 Public Hearing Comments-Countryside Better Together Edina Project: Public Hearing: 5701 Benton Ave., Countryside Elementary VISITORS 12 CONTRIBUTORS 3 RESPONSES 3 1 Registered 0 Unverified 2 Anonymous 1 Registered 0 Unverified 2 Anonymous Respondent No:1 Login:Anonymous Email:n/a Responded At:Jun 22, 2022 15:02:51 pm Last Seen:Jun 22, 2022 15:02:51 pm IP Address:n/a Q1.First and Last Name Jerry Groven Q2.Address 5716 Benton Ave Q3.Comment I have a couple of comments/questions and concerns: 1.) The map above is missing two crosswalks that are currently installed and important to the pedestrians in the neighborhood. First one crossing Stuart Ave at the intersection of Benton Ave. The second one crossing Benton at Stuart Ave. 2.) I believe that Benton ave. on the North side of the road from Stuart avenue to Tracy avenue should have a sidewalk to bring the pedestrians on North side of Benton to the intersection of Benton and Stuart ave to access Countryside Elementary. 3.) Questions about flow of dotted blue line on map above. I think it will work as shown, I just would like clarification on the flow. If you follow the dotted blue line for drop off/pickup it shows coming down Stuart going South, going in front of the school, then leaving East on Benton. That sounds good. Is that to mean parents will not be going West down Benton to turn left on Stuart to access the line? Would the parking lot be 'blocked' so parents can't bypass the traffic flow and turn left into the parking lot then exit on Stuart? Respondent No:2 Login:Liz Olson Email:lkolson@EdinaMN.gov Responded At:Jun 23, 2022 08:40:41 am Last Seen:Jul 22, 2022 12:32:51 pm IP Address:156.142.185.16 Q1.First and Last Name City of Edina Planning Staff Q2.Address 4801 50th St. W., Edina, MN Q3.Comment Mr. Jerry Groven, Responses to your questions are below: 1. The two crosswalks at Stuart and Benton will remain. They were not shown because they were not in the project limits. 2. A sidewalk along the north side of Benton Ave between Stuart and Tracy is outside the project limits. Sidewalk discussions along roadways should be discussed with City’s Engineering Department. FYI - that location is not on the Bike and Pedestrian Master Plan. 3. Parents will be able to go west down Benton or south on Stuart to access the parking lot from the west. How the school will control traffic on the east end of the parking lot is a question for the school district. We believe they will not allow entering on the east end of the parking lot. If you have additional questions, please use the Questions tab (located to the right side of the public hearing comment tab in Better Together Edina). Please call the Planning Division at 952-826-0369 for help. Respondent No:3 Login:Anonymous Email:n/a Responded At:Jun 23, 2022 08:52:33 am Last Seen:Jun 23, 2022 08:52:33 am IP Address:n/a Q1.First and Last Name Leffert Tigelaar and Barbara Kyle Q2.Address 5816 Stuart Avenue, Edina MN 55436 Q3.Comment We have lived at 5816 Stuart Avenue (at cul-de-sac just west of Countryside Elementary parking lot) since 1995. We have made many improvements to our property throughout our time here and have seen many changes at Countryside during that time too. A month, or so, ago we were made aware that the school is planning to redefine their curriculum and that infrastructure changes were being planned to accommodate the additional student load associated with that and to improve student safety. We initially scanned the documents that were submitted and were able to discuss these plans with the architects, civil engineer, principal, and the facilities manager for Edina Public Schools and we expressed a few concerns. It appears that most of our concerns have been considered, but not all have been fully addressed. The proposed curriculum changes and proposed expansion of the facilities, student body will increase associated traffic around the school and on feeder roads to the immediate area. It is very difficult to understand why Countryside Elementary is thought to be the best school to expand given how highly reliant it is on a few residential streets (Benton and Stuart and Grove) and feeder streets deep into the neighborhood to provide access to the school. Residents on Benton, Stuart and Grove are pretty much stuck on their properties during drop-off and pick up times. Separating bus and automobile traffic in this proposal is a sound idea that will improve student safety around the school and we are in support of that goal, though below we outline a few concerns about the proposed plans for implementation: 1) Lighting levels on the west side of the Stuart Ave right-of-way, all other neighboring right-of-way the levels read as 0.0, just in front of our home the highest reading is .9 in the public right-of- way. There are also above “zero” readings on Benton Avenue, just east of the Benton Stuart Avenue. Just east of the higher reading on Stuart Avenue, the highest light levels on the entire school property can be found. A 2.6 reading being the highest number. There currently is significant glare which, in addition to school signage “one way” in the public right-of-way (just south of our driveway) gives the impression that the public right-of-way is school district property. We want to make sure that the school district and their consultants working on the planning of changes understand that the cul-de-sac in front of our home is public-right-of-way and we expect that the planning and building department will enforce zoning/building code adherence for this. 2) It is not clear from the documentation how the school district would meet screening requirements of parking lots from residential properties. a. We would like to see a serious good faith effort by the school district to plan, install and properly maintain code required screening of parking lots (as a minimum) . b. Up to this date, the burden of light pollution has been extreme for the residential properties facing the parking lot on Benton and Stuart Avenue. With the expansion of the school parking infrastructure, we insist that there is a good faith effort made to screen this proposed enlarged visual, light polluting, nuisance and that the city enforces codes related to that. 3) It appears that the “Not for Construction” Site Plan by Wold has addressed our concern about the contiguous width of the two driveways to the parking lot and drop of from the Stuart Avenue “cul-de-sac”, by pulling the berm between the driveways forward toward the curb creating two curb cuts that meet code. Unfortunately, this change is not represented on the Site Diagrams included in the “Countryside Plans and renderings” package, which we suspect is a document coordination oversight. The CITY ofEDINA Conditional Use Permit –Edina Public Schools (Countryside) The CITY ofEDINA EdinaMN.gov 2 The CITY ofEDINA EdinaMN.gov 3 The CITY ofEDINA EdinaMN.gov 4 The CITY ofEDINA EdinaMN.gov 5 The CITY ofEDINA EdinaMN.gov 6 The CITY ofEDINA EdinaMN.gov 7 The CITY ofEDINA EdinaMN.gov 8 The CITY ofEDINA EdinaMN.gov 9 City Standard Proposed Front/parking – Benton Avenue Side Street/parking – Tracy Ave. Side Street/parking – Stuart Ave. Side – South/building Side – West/building Front – North/building Front – East/building 20 feet 20 feet 20 feet 50 feet 50 feet 50 feet 50 feet 20 feet (existing) 38 feet 20 feet (existing) 100+ feet (existing) 100+ feet (existing) 57 feet (existing) 140 feet Parking Stalls 78 126 The CITY ofEDINA EdinaMN.gov 10 The CITY ofEDINAPrimary Issue Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 11 1. The Conditional Use Permit criteria is met. a) Does not have an undue adverse impact on governmental facilities, utilities, services or existing or proposed improvements. b) Will generate traffic within the capacity of the streets serving the property. c) Does not have an undue adverse impact on the public health, safety, or welfare. d) Will not impede the normal and orderly development and improvement of other property in the vicinity. e) Conforms to the applicable restrictions and special conditions of the district in which it is located as imposed by this Section; and f) is consistent with the Comprehensive Plan. The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 12 2. The proposal meets all minimum Zoning Ordinance standards. All setback requirements and lighting standards would be met. 3. The proposal would improve traffic and circulation on the site. The number of parking stalls remains in compliance the Zoning Ordinance. The new driveway would only be for buses and staff. Parent drop-offs would continue off Benton Avenue. Staff and buses will be able to enter and exit from both Tracy Ave and Countryside Rd. Engineering staff has reviewed the left-hand turn movements on Tracy Avenue and feel there would be adequate sight lines. Staff believes the timing of student crossings compared to staff entering and exiting the site will be different and thus not create additional issues for crossing of Tracy. If the project is implemented, city staff can monitor the number of crossings of Tracy at the crosswalk to determine if pedestrian flashers are warranted to add extra notification of crossings. Staff believes there is adequate sight lines of the crosswalk today. The project would not change those sightlines. The school may also consider crossing guards to assist with crossings. The CITY ofEDINAPrimary Issues Is the Conditional Use Permit (CUP) criteria met? Yes, Staff believes the criteria is met. EdinaMN.gov 13 4. The plan includes landscaping and trees planted along Tracy Avenue and around the re- located maintenance building to provide partial screening. Staff does recommend additional plantings along Tracy and Benton to provide additional screening of the parking lot. The CITY ofEDINAStaff Recommendation EdinaMN.gov 14 Motion to close the public hearing at noon on July 25, 2022, and continue action to the August 3 City Council meeting. The CITY ofEDINAStaff & PC Recommendation EdinaMN.gov 16 Recommend that the City Council approve the Conditional Use Permit to expand the parking area for Countryside School at 5701 Benton Avenue. Approval is based on the following findings: 1. The proposal meets the Conditional Use Permit conditions per Chapter 36 Sec. 36-305 of the Edina Zoning Ordinance. 2. The proposal meets all applicable Zoning Ordinance requirements. 3. The proposed project meets all city code provisions and is consistent with the Comprehensive Plan. Public schools and associated parking lots are a conditionally permitted use within the R-1 Zoning District. The CITY ofEDINAStaff & PC Recommendation EdinaMN.gov 17 Approval is subject to the following conditions: 1. The site must be developed and maintained in conformance with the following plans: • Site plan date stamped May 22, 2022. • Plan modifications dated May 27, 2022. • Lighting photometric May 22, 2022. • Grading and drainage plan date stamped May 22, 2022. • Landscaping plan date stamped May 22, 2022 • Geometric plan date stamped May 22, 2022 • Utility and erosion control plan date stamped May 22, 2022. 2. A building and grading permit is required for the improvements. 3. A lighting plan, landscape plan and grading plan must be submitted, and meet all minimum zoning ordinance requirements. 4. Submit a copy of the Nine Mile Creek Watershed District permit. The city may require revisions to the approved plans to meet the district’s requirements. 5. Additional evergreens along Benton and Tracy must be planted to fill in the gaps of existing and proposed landscaping to provide better screening of the parking lots for residents across the street from the school. Final Landscape Plan and additional screening is subject to review and approval of the city forester prior to issuance of a building permit. Date: August 3, 2022 Agenda Item #: IX.A. To:Mayor and City Council Item Type: Other From:Lisa A. Schaefer, Assistant City Manager Item Activity: Subject:Quarterly Business Reports Information CITY OF EDINA 4801 West 50th Street Edina, MN 55424 www.edinamn.gov ACTION REQUESTED: None. INTRODUCTION: The latest updates to the 2022 Budget Work Plan are attached, as well as the Quarterly Finance Report and most updated Race & Equity Work Plan. ATTACHMENTS: Description 2022 Budget Work Plan Q2 updates Q2 2022 Finance Report Q2 2022 Race & Equity Work Plan Updates 2022—2023 Proposed Budget Work Plan Strategies Q1 Update April 19, 2022 BUDGET STRATEGIES P a g e | 1 2022—2023 BUDGET STRATEGIES 1A As debt levies expire, increase the Capital Improvement Plan (CIP) Levy by equivalent amount to establish reliable funding for ongoing building maintenance, replacement, and capital improvements. Ongoing Finance Update: 7/11/22—City staff will present projects to Council members at the 7/19/22 Council Work Session and the first draft of the City Manager CIP recommendations are slated to be presented at the 8/16/22 Council Work Session. 1B Host local option sales tax referendum in 2022 general election. If approved, implement the results. Q4 2022 Finance Update: 7/11/22 (Finance)—The 2022 legislative session concluded without legislation passing to authorize Edina voters to decide on using sales tax to finance the Braemar Arena expansion project. Therefore, City staff are preparing ballot questions that ask Edina residents to consider a half-percent sales tax to finance improvements at Fred Richards Park and Braemar Park and Arena. 7/25/22 (Comm)—EdinaAtPlay.org launched to provide voters with information on the referendum. The Communications Department posts about the referendum on social media at least twice per week to drive traffic to the website. Signage is up at Fred Richards Park, Braemar Golf Course, Courtney Fields and the Mooty Pickleball Courts and planned for Braemar Arena and City Hall. Town Talks have been held on the Fred Richards Park and Braemar Park master plans and one will be held Sept. 1 on the mechanics of a local option sales tax. 1C Approve a clean water strategy for surface waters. Q3 2022 Engineering Update: 7/18/22—Consultant conducting data review and preliminary memo. Staff presenting at Aug. 3 City Council Work Session. 1D Develop funding strategy to implement a street lighting system and maintenance plan that balances sustainability, public safety, and quality of life goals, including increasing energy efficiency, ensuring safely lit community, and minimizing light pollution. Q4 2022 Engineering Update: 7/18/22—Staff analysis complete. Preparing information for a future work session review. 1E Implement Morningside Flood Infrastructure Project. Q4 2023 Engineering Update: 7/18/22—Major grading operations are underway in Weber Park. Weber pond and Lynn/Kipling areas will be graded this winter. 1F Consider recommendations from Parks & Recreation Commission for using alternative funding methods for park improvements and determine next steps. Q3 2022 Finance Update: 7/11/22—Funding methods for park improvements are being explored through CIP review and discussions. 2022—2023 Proposed Budget Work Plan Strategies Q1 Update April 19, 2022 BUDGET STRATEGIES P a g e | 2 1G Reassess City Hall space needs for post-pandemic service delivery. Q1 2023 Facilities Update: 7/18/22—Project kick-off will be considered in Q4 2022, following completion of Strategy #2D (Evaluate post-pandemic service- delivery) which is in progress by the Administration Department. 1H Acquire Fire Station #2 site. Determine finance method/plans. Select a project architect. Approve construction plans to ensure the building satisfies the needs of City staff to provide 24-hour fire and EMS operations. Include office space for Community Health division within the Station #2 site. Q2 2022 Fire/Facilities Update: 7/18/22—Final site was selected on 76th Street. Property is under contract with closing anticipated by Sept 1, 2022. City bonding to purchase site underway. Request for proposals for engineer/architect are in draft form. Hire expected after responses and interviews in October. 1I Determine finance method and plan for Fire Station #3 in the northeast quadrant of the City. Propose and acquire site after Station #2 site is determined, utilizing response models to provide efficient emergency response to all residents. Q4 2023 Finance Update: 7/26/22—On hold following selection process for architect/design team for Station 2. Staff will engage in Station 3 site possibilities and review response times for locations. 1J Expand the City’s fiber optic network for faster and more secure connections. Q3 2023 IT Update: 7/22/22—Additional sites (Utilities) have been approved by Council and projects are underway. 1K Replace Public Safety Computer-aided Dispatch (CAD) and Record Management System (RMS). Go live Q1 2023. Q1 2023 Police Update: 7/21/22—CAD/RMS install/training is occurring now. 2A Determine long-term plan for future of Art Center building and delivery of art programs. Q1 2022 Parks & Rec Update: 7/25/22—Delivered pottery forward facility study to the City Council at the March 22 Work Session. Until greater direction is received on a new arts facility, staff will continue to offer arts programming at existing park facilities for a variety of programs. 2B Increase resources, training, and coordination for responding to mental health-related calls for service. Q4 2022 Police/Fire/ Admin Update: 7/21/22—(Police) Work is on-going. Embedded social worker in place. Increased cases this quarter. 7/26/22 (Fire) Staff have selected a mental health provider for training and consultation for mental health. Legal counsel is reviewing the contract proposal. 2C Implement new agreement with Edina Public Schools (EPS) regarding election administration for 2022 and beyond. 2022—2023 Proposed Budget Work Plan Strategies Q1 Update April 19, 2022 BUDGET STRATEGIES P a g e | 3 Q1 2022 Admin Update: 7/29/22—In progress. City staff met with EPS staff in January to begin discussions and presented to School Board on 4/11/22. Statewide elections are held in in 2022, and EPS is not planning any special elections. City staff have drafted a proposal for 2023 EPS elections that we will share with EPS staff. A contract will go to City Council and EPS Board for approval later this year. 2D Evaluate remote work and services delivery—long-term impact post- COVID to ensure: Resources for employee mental health and work/life balance Part-time / seasonal staffing model and compensation Ongoing HR Update: 7/27/22—In the process of reviewing the part-time/seasonal staffing model and compensation. As part of benefits renewal, looking at resources to better support employees in the mental health arena. 3A Continue implementing strategies to create affordable housing units using the affordable housing trust fund and other applicable sources; explore acquiring another parcel for a multi-housing development; continue developing single family and multi-family preservation strategies. (Q2) Q2 2022 Community Dev Update: 7/21/22—Expanded housing preservation program with Emerging Developer Pilot in order to increase capacity. Added funds to rehab program. Still looking for next development opportunity. Expanded the affordable/attainable count in Fred II. 3B Implement sustainable building policy to incent sustainable building and operational practices for new development and redevelopment. Q4 2023 Engineering Update: 7/18/22—Policy implementation started in April. County cooperative review process not occurring this year as planned. Staff hired LHB to assist with development reviews. 3C Execute and implement redevelopment agreements for 5146 Eden Ave. Q2 2022 Community Dev Update: 7/25/22—Sales contracts for redevelopment were executed on 6/2/22 for cooperative housing and a restaurant next to a public green space. Architectural drawings have been prepared for each of these three elements and submitted in late July for future rezoning consideration by the Planning Commission and the City Council. 3D Evaluate the feasibility of creating district parking in the 44th and France Area per the 44th and France Small Area Plan, including parameters that balance current transportation needs and sustainability goals. Q2 2022 Community Dev Update: 7/27/22—No new information is available. Key property owners have not yet re-opened after temporary Covid-19 related closures. 3E Prepare a District Plan for the Cahill Industrial Park. Q1 2023 Community Dev Update: 7/25/2022—Project continues. Second community meeting will be held in early August. The City received a $50,000 grant from 2022—2023 Proposed Budget Work Plan Strategies Q1 Update April 19, 2022 BUDGET STRATEGIES P a g e | 4 Hennepin County to expand the scope of the project. Expanded scope will focus on connectivity in the district and public realm. 3F Implement recommendations of the Housing Strategy Task Force final report. Ongoing Community Dev Update: 7/21/22—New concepts are weighed against recommended strategies. Programs are developed based on strategies, such as the expansion of the Housing Preservation Program. 3G Determine spending plan for available TIF funds by 2022. Q2 2022 Community Dev Update: 7/25/22—Modifications will be considered by the 12/31/22 deadline. 3H Explore ways City can incent expansion of broadband high-speed internet to public. Q3 2022 Community Dev Update: 7/21/22—Applications are still being accepted for the internet essentials program, although the volume has slowed down considerably. 3I Implement strategies to increase organics participation to 50% (currently 32%) and tonnage to 200 per month (currently 100) by 2023. Q3 2022 Fire-Health Update: 7/25/22—Staff is attending local community events to market the initiative and effects of the program. 3J Implement strategies to create affordable/workforce housing (between 992 and 1,804 units by 2030). Ongoing Community Dev Update: 7/21/22—Financing on 4040 W. 70th St. closed and groundbreaking is scheduled for July 2022. To date, 303 affordable units have been approved, or 16.8% on way to goal. 4A Complete final report of the 2018 Racial Equity Implementation Plan and incorporate race & equity goals into ongoing department work plans. (Operationalize equity plans.) Q1 2022 Admin Update: 7/26/22—Final report on 2018 R&E Implementation Plan provided on 6/21/22. Department work plans have incorporated R&E goals into work items. 4B Create strategy, tools, and templates for better alignment and measurement of Council Values (Community Engagement, Sustainability, Community Health, and Race & Equity) into City decision-making, and provide quarterly resources and activities for City Council. Q4 2023 Admin Update: 7/15/22—The Values Viewfinder team has developed a tool which is being used for CIP, Fire Station 2, and Strachauer Park master plan. Values Viewfinder team is scheduled to go to City Council’s work session in November. 4C Continue implementation of recruitment and selection strategy for Boards & Commissions to better reflect diversity reflective of demographics in Edina. Q4 2023 Admin Update: 7/15/22—2022 onboarding complete. Developed interview guide for City Council. Will conduct a member assessment before the 2023 onboarding process. 2022—2023 Proposed Budget Work Plan Strategies Q1 Update April 19, 2022 BUDGET STRATEGIES P a g e | 5 4D Administer 2023 Quality of Live Survey. Q3 2023 Comm Update: 7/25/22—Work will not begin on the 2023 survey until late 2022. However, as part of the referendum, a statistically valid survey was conducted in February 2022 with a few questions typically asked in the Quality of Life Survey. 4E Evaluate and implement transparency tools and dashboards for City budget and overall performance. Q3 2023 Admin Update: 7/15/22—Demos are complete. Project team will select a vendor in August. 4F Use an equity lens to evaluate City complaint response process and procedures. Q1 2023 Admin Update: 7/26/22—Project team reviewing City correspondence letters, staff resources, technology programs to support with tracking and organization communications. 4G Ensure successful implementation of ARPA Funding. Q4 2022 Admin Update: 7/26/22—In progress. Engagement portion is complete. Staff conducted community and internal staff meetings in April to collect ideas. Staff will present recommendations to Council in November. 4H Review Race & Equity Task Force recommendations to incorporate into Priority Use agreements with athletics associations. Q1 2023 Parks & Rec Update: 7/25/22—This initiative is planned for the 2023 Department Work Plan. City of Edina – Q2 2022 Summary of the City’s financial performance by fund for June YTD 2022 General Fund • Fines and Forfeitures – Court fines are down due to decreased traffic stops. • Investment Income – $400k in investment income offset by $4M in unrealized losses. As we hold investments to maturity, these will not become realized losses and reflect the current adjustment to market value. • Property Taxes – Property taxes are the primary revenue source and are received in June and December. We received the $17.3 in June and another $4.1M in July for a total of $21.4M. • Franchise Fees – Payments are recorded quarterly but lag the quarter close. For example, first quarter franchise fees arrive in April/May. • Licenses & Permits - Building permit revenue fluctuates with changes in the number of permits issued and valuation of projects. June YTD 2022 has 1,178 permits with a valuation of $254M compared to same period in the prior year of 2,367 permits with a valuation of $170M. The higher valuation in 2022 is due to the 4917 Eden Avenue (former Perkins restaurant) and The Fred apartments projects. • Intergovernmental –2022 has $2.5M of federal ARPA funding. Similar to prior year, unspent amounts will be deferred. • Building Rental – Driven by cell tower contracts which have revenue recorded in the first quarter. • Expenses – Generally, 25% of budgeted expenses are recognized each quarter. June YTD includes 12 payroll periods, which is 46% of total annual pay periods. • Contributions & Transfers – In 2021, $4.5M of 2020 surplus was transferred out ($4.2M Construction Fund and $300k HRA affordable housing). 2022 budgeted transfer is $150k from the Utility Fund. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Fines and Forfeit 128,102 650,000 460,914 20% Invmnt Inc - Non Op (3,594,233) 250,000 (151,907) -1438% Other Revenue 60,157 36,500 186,591 165% Property Taxes 17,300,000 36,708,036 33,827,443 47% Franchise Fee 202,319 810,000 824,286 25% Lodging Tax 8,187 20,000 17,214 41% Licenses & Permits 3,517,059 5,391,060 6,008,225 65% Intergovernmental 2,855,003 1,888,750 2,564,397 151% Charges for Services 2,377,375 5,738,405 5,536,785 41% Building Rental 371,892 339,000 491,578 110% Total Revenues 23,225,861 51,831,751 49,765,527 45% Expenses Salaries (11,464,846) (26,123,094) (24,571,030) 44% Benefits (4,231,734) (10,332,092) (10,540,716) 41% Contractual Services (3,558,077) (8,290,015) (6,956,577) 43% Commodities (870,603) (2,478,344) (2,116,567) 35% Capital Outlay (35,650) - (26,676) - Internal Services (2,504,103) (5,008,206) (4,850,825) 50% Total Expenses (22,665,014) (52,231,751) (49,062,390) 43% Net Operating Inc/Loss 560,847 (400,000) 703,138 Non-Operating Rev/Exp Sale of Property 8,313 - - - Misc - Non Op 1,656 - (112,211) - Contrib & Transfers 30,758 150,000 (4,060,500) 21% Total Non-Operating Rev/Exp 40,727 150,000 (4,172,710) 27% Net Inc/(Loss)601,574 (250,000) (3,469,573) Parks & Recreation Enterprises The financials below for the Parks & Recreation business-like enterprises include two cost recovery measures. The “Total Cost Recovery” measure indicates the percentage of operating costs that are covered by revenue generated by the enterprise. “Management Cost Recovery” measures the degree to which the business is recovering controllable costs (i.e., excludes internal charges and depreciation). Art Center • The Art Center continues to be open with limited use on the main level only. Other facilities are also being utilized for art programming. • 2021 audited amounts include favorable pension adjustment showing under benefits. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services - 26,725 - 0% Sales - 18,255 28 0% Memberships - 15,664 - 0% Admissions 51,729 422,070 62,166 12% Other Fees - 19,769 14,215 0% Sales - Utilities - - - - Total Revenues 51,729 502,483 76,409 10% Expenses Cost of Sales & Srvc - (500) - 0% Salaries (68,835) (483,569) (161,030) 14% Benefits (11,824) (98,727) 175,706 12% Contractual Services (28,671) (114,819) (37,785) 25% Commodities (9,735) (76,500) (14,327) 13% Internal Services (31,229) (62,457) (75,838) 50% Depreciation (3,000) (6,000) (5,891) 50% Total Expenses (153,295) (842,572) (119,166) 18% Net Operating Inc/Loss (101,566) (340,089) (42,758) Non-Operating Rev/Exp Donations - Non Op 10,432 - 1,402 - Contrib & Transfers - 350,000 250,000 0% Total Non-Operating Rev/Exp 10,432 350,000 251,402 3% Net Inc/(Loss)(91,133) 9,911 208,644 Total Cost Recovery 34% 60% 64% Management Cost Recovery 44% 65% 207% 0 500 1,000 1,500 2,000 2019 2020 2021 2022 Class Registrations by Quarter Q1 Q2 Q3 Q4 Braemar Golf Course & Dome • Memberships has increased due to the number of player’s cards sold – 1,900 2022; 1,300 2021; 750 2020. • Admissions mostly contains golf dome revenue. Timed golf sessions increased by 13,412 YTD 2022 or 69,080 for the 2021/22 season. • Building rental is primarily Red River Kitchen revenue. Total revenue to the City is $85k compared to $46k for the same period in 2021 due to post-COVID catering and increased programming. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services 2,620 - 261 - Sales 152,294 260,000 309,948 59% Memberships 247,417 130,000 201,499 190% Admissions 1,228,610 900,000 1,170,367 137% Building Rental 85,100 190,000 155,073 45% Equipment Rental 136,376 340,000 381,616 40% Greens Fees 1,444,163 2,680,000 3,147,709 54% Other Fees 446 11,500 18,210 4% Total Revenues 3,297,026 4,511,500 5,384,683 73% Expenses Cost of Sales & Srvc (122,812) (191,000) (235,073) 64% Salaries (766,660) (1,573,510) (1,743,468) 49% Benefits (175,504) (387,032) (528,330) 45% Contractual Services (361,501) (671,500) (701,718) 54% Commodities (153,923) (390,000) (490,250) 39% Internal Services (161,331) (322,661) (242,329) 50% Depreciation (449,502) (899,000) (894,499) 50% Total Expenses (2,191,233) (4,434,703) (4,835,666) 49% Net Operating Inc/Loss 1,105,793 76,797 549,017 1440% Non-Operating Rev/Exp Gain/Loss on Asset 4,989 - Invmnt Inc - Non Op 8 9,000 (6,229) 0% Donations - Non Op 30,000 - - - Intergovernmental (3,105) - - - Int & Fiscal Charges (134,054) (201,254) (113,643) 67% Contrib & Transfers 28,552 50,550 53,363 56% Total Non-Operating Rev/Exp (73,610) (141,704) (66,509) 52% Net Inc/(Loss)1,032,182 (64,907) 482,508 -1590% Total Cost Recovery 150% 102% 111% Management Cost Recovery 212% 143% 148% 0 10,000 20,000 30,000 40,000 2021 2022 YTD Dome Timed Golf & Course Range Buckets # of Dome Timed Golf # of Range Buckets - 5,000 10,000 15,000 20,000 25,000 30,000 35,000 2020 2021 2022 YTD Golf Rounds 18H Rounds 9H Rounds A9 Rounds Aquatic Center – 2022 season is June 10 through August 21; thus June represents approximately 1/3 of revenue for admissions and building rentals. Contractual Services and commodities pace ahead with preparation for the season. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services 606 5,500 6,736 11% Sales 56,286 127,000 155,701 44% Memberships 394,201 440,000 371,891 90% Admissions 141,553 415,000 468,839 34% Building Rental 27,062 70,720 66,651 38% Other Fees - 850 (94) 0% Total Revenues 619,707 1,059,070 1,069,724 59% Expenses Cost of Sales & Srvc (33,788) (51,750) (60,370) 65% Salaries (94,475) (453,360) (323,487) 21% Benefits (14,573) (65,155) (58,891) 22% Contractual Services (90,358) (190,509) (232,907) 47% Commodities (63,118) (132,600) (75,914) 48% Internal Services (20,910) (41,819) (44,281) 50% Depreciation (145,002) (290,000) (283,470) 50% Total Expenses (462,223) (1,225,193) (1,079,319) 38% Net Operating Inc/Loss 157,484 (166,123) (9,595) Non-Operating Rev/Exp Invmnt Inc - Non Op - 20,000 (10,211) 0% Int & Fiscal Charges (10,700) (7,439) 6,137 144% Misc - Non Op - - 15,164 Contrib & Transfers 1,354 15,000 17,269 9% Total Non-Operating Rev/Exp (9,346) 27,561 28,359 -34% Net Inc/(Loss)148,138 (138,562) 18,764 Total Cost Recovery 134% 86% 99% Management Cost Recovery 210% 120% 146% 0 500 1,000 1,500 2,000 2,500 3,000 3,500 4,000 4,500 5,000 2019 2020 2021 2022 Quarterly Season Passes Sold Q1 Q2 Q3 Q4 - 5,000 10,000 15,000 20,000 25,000 30,000 35,000 40,000 45,000 2019 2020 2021 2022 Daily Admissions Q1 Q2 Q3 Q4 Edinborough Park - Edinborough Park has resumed normal operations and continues to see an increase in use since February. The concession stand remains closed due to prioritizing limited staffing to customer service. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Lodging Tax 1,360 - 3,090 - Charges for Services 4,899 10,000 6,968 49% Sales 16,102 135,000 9,396 12% Memberships 58,168 90,000 77,902 65% Admissions 396,729 698,000 255,945 57% Building Rental 119,310 230,904 116,444 52% Greens Fees 828 - 329 - Other Fees 113,347 225,000 207,179 50% Total Revenues 710,743 1,388,904 677,252 51% Expenses Cost of Sales & Srvc (603) (78,000) (1,099) 1% Salaries (271,406) (684,119) (559,997) 40% Benefits (98,469) (226,020) (85,832) 44% Contractual Services (144,186) (371,476) (383,942) 39% Commodities (81,243) (171,750) (104,226) 47% Internal Services (74,577) (149,155) (144,833) 50% Depreciation (70,000) (140,000) (100,562) 50% Total Expenses (740,485) (1,820,520) (1,380,490) 41% Net Operating Inc/Loss (29,742) (431,616) (703,238) Non-Operating Rev/Exp Invmnt Inc - Non Op - 11,000 (3,405) 0% Misc - Non Op 1,514 - 15,302 - Contrib & Transfers 4,881 11,000 12,673 44% Total Non-Operating Rev/Exp 6,395 22,000 24,570 29% Net Inc/(Loss)(23,347) (409,616) (678,668) Total Cost Recovery 96% 76% 49% Management Cost Recovery 120% 91% 60% - 20,000 40,000 60,000 80,000 100,000 120,000 2019 2020 2021 2022 Quarterly Daily Admissions Q1 Q2 Q3 Q4 - 100 200 300 400 500 600 700 800 900 2019 2020 2021 2022 Birthday Parties Q1 Q2 Q3 Q4 Braemar Arena and Field * Utilization – represents hours scheduled out of total hours available. Prime vs nonprime is dependent upon the time of day and time of year, which is charged at differing rates. Braemar Arena – Fully open, including concessions. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services 64,100 75,500 94,946 85% Sales 119,052 309,500 175,297 38% Admissions 156,100 245,000 137,536 64% Building Rental 1,136,824 1,996,739 1,934,360 57% Equipment Rental 3,320 6,000 2,144 55% Other Fees 4,866 - 2,787 - Total Revenues 1,484,263 2,632,739 2,347,070 56% Expenses Cost of Sales & Srvc (52,385) (111,000) (67,517) 47% Salaries (395,909) (973,971) (790,606) 41% Benefits (107,180) (230,348) (199,601) 47% Contractual Services (441,237) (1,062,622) (843,936) 42% Commodities (30,461) (134,250) (73,955) 23% Internal Services (118,058) (236,115) (212,718) 50% Depreciation (330,000) (660,000) (657,745) 50% Total Expenses (1,475,229) (3,408,306) (2,846,078) 43% Net Operating Inc/Loss 9,034 (775,567) (499,008) Non-Operating Rev/Exp Invmnt Inc - Non Op 24 3,000 (1,186) 1% Misc - Non Op 2,183 - 608 - Int & Fiscal Charges (36,012) (64,109) (60,603) 56% Contrib & Transfers 21,669 340,000 340,605 6% Total Non-Operating Rev/Exp (12,136) 278,891 279,424 -4% Net Inc/(Loss)(3,102) (496,676) (219,584) Total Cost Recovery 101% 77% 82% Management Cost Recovery 148% 107% 121% 72%73% 42% 24% 72%66%73% 56% 0% 20% 40% 60% 80% Utilization % - prime Utilization % - nonprime YTD Braemar Arena Ice Hours Utilization* 2019 2020 2021 2022 76% 15%29%12% 82% 47% 96% 37% 0% 50% 100% 150% Utilization % - prime Utilization % - nonprime YTD Braemar Field Hours Utilization* 2019 2020 2021 2022 Braemar Field • Utilization – Increase in prime utilization is attributable to the late spring. • Salary and Benefits – Differences to budget are due to allocation of staff time between the arena and the field. 2021 audited amounts include favorable pension adjustment showing under benefits. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services - - 116 - Admissions 15,805 25,000 6,167 63% Building Rental 326,559 485,000 482,579 67% Other Fees 275 - 34 0% Total Revenues 342,364 510,000 488,862 67% Expenses Salaries (70,265) (122,936) (120,479) 57% Benefits (15,840) (22,357) 79,096 71% Contractual Services (109,679) (202,070) (131,957) 54% Commodities (2,268) (23,250) (10,949) 10% Internal Services (18,785) (37,569) (35,719) 50% Depreciation (256,998) (514,000) (523,926) 50% Total Expenses (473,834) (922,182) (743,933) 51% Net Operating Inc/Loss (131,195) (412,182) (255,037) Non-Operating Rev/Exp Sale of Property - - - - Invmnt Inc - Non Op - 11,000 (5,278) 0% Contrib & Transfers 604 950 692 64% Total Non-Operating Rev/Exp 604 11,950 (4,586) 5% Net Inc/(Loss)(130,591) (400,232) (259,623) Total Cost Recovery 72% 55% 66% Management Cost Recovery 173% 138% 266% Centennial Lakes Park • Equipment Rental – attributable to the increase in skate rentals (12,245 skates for 2022 compared to 1,199 in 2021, 7,429 in 2020 and 11,256 in 2019). • Green Fees represent the putting course with an increase in second quarter rounds (10,713 for 2022 vs 8,479 in 2021). • Other Fees - Mostly comprised of park maintenance fees from surrounding properties. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Charges for Services - - 90 - Sales 17,825 25,000 15,155 71% Admissions 390 - 1,455 - Building Rental 32,362 86,000 65,933 38% Equipment Rental 137,340 145,000 108,923 95% Greens Fees 105,533 240,000 269,667 44% Other Fees 161,126 320,000 401,874 50% Total Revenues 454,576 816,000 863,096 56% Expenses Cost of Sales & Srvc (6,293) (12,000) (9,606) 52% Salaries (221,824) (600,876) (396,920) 37% Benefits (76,744) (182,860) (157,964) 42% Contractual Services (97,880) (277,318) (289,219) 35% Commodities (55,239) (143,500) (83,956) 38% Internal Services (64,056) (128,113) (113,057) 50% Depreciation (18,498) (37,000) (37,145) 50% Total Expenses (540,535) (1,381,667) (1,087,867) 39% Net Operating Inc/Loss (85,959) (565,667) (224,771) Non-Operating Rev/Exp Invmnt Inc - Non Op - 4,000 (1,513) 0% Donations - Non Op 10,642 - 2,200 - Misc - Non Op 212 - 1,247 - Contrib & Transfers 6,114 420,000 149,112 1% Total Non-Operating Rev/Exp 16,969 424,000 151,046 4% Net Inc/(Loss)(68,990) (141,667) (73,725) Total Cost Recovery 84% 59% 79% Management Cost Recovery 101% 70% 97% 0 5,000 10,000 15,000 20,000 25,000 2019 2020 2021 2022 # of Putting Course Rounds Q1 Q2 Q3 Q4 Liquor Fund • Total revenue is down slightly vs prior year at $6.6M June YTD 2022 to $6.7M same period 2021. o POS raw sales are $6.5M June YTD 2022 vs $6.7M for the same period 2021. o Online sales for June YTD 2022 are $258k compared to $475k for the same period 2021. o With phasing out of current loyalty program in preparation for new software, $104k of previously deferred revenue has come back to revenue. • Customer count is 191k for June YTD 2022 compared to 196k in 2021. Average Transaction Value (ATV) remains at $38 for Q2 2022. Annual average was $38 in 2021, $47 in 2020 (customers made fewer visits with higher purchases during pandemic) and $31 in 2019. • Q2 2022 margin increased to 29.8% from 28.9% in Q1 compared to 27.6% for all of 2021 and 30% pre-pandemic. Prices have been adjusted to account for higher product cost. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Sales 6,623,393 15,112,595 14,309,469 44% Other Fees (801) - 3,764 - Total Revenues 6,622,592 15,112,595 14,313,232 44% Expenses Cost of Sales & Srvc (4,691,305) (10,582,911) (10,353,201) 44% Salaries (756,716) (1,722,873) (1,599,592) 44% Benefits (235,595) (643,756) (389,216) 37% Contractual Services (354,759) (687,123) (686,620) 52% Commodities (67,453) (76,300) (57,598) 88% Internal Services (198,684) (397,369) (312,725) 50% Depreciation (58,500) (117,000) (120,830) 50% Total Expenses (6,363,013) (14,227,332) (13,519,781) 45% Net Operating Inc/Loss 259,579 885,263 793,451 Non-Operating Rev/Exp Invmnt Inc - Non Op - 21,000 (13,298) 0% Contrib & Transfers 2,173 (996,500) (845,844) 0% Misc - Non Op (0) 345 Total Non-Operating Rev/Exp 2,173 (975,500) (858,798) 0% Net Inc/(Loss)261,752 (90,237) (65,346) $- $20 $40 $60 $80 - 50 100 150 Average Transaction Value (ATV)Customer Count (in 000's)Customer Count by Store & Total ATV 50th Southdale Grandview ATV 20% 25% 30% 35% 40% Q1 20 Q2 20 Q3 20 Q4 20 Q1 21 Q2 21 Q3 21 Q4 21 Q1 22 Q2 22 Liquor Store Margin MN Muni off-sale Spirits Beer Wine Total Utility Fund • For 2022, utility rates increased 5% for water and sewer and 8% for storm. The % of Budget for water, sewer and storm charges lag 50% due to year-end cutoff procedures. Bills for January through March include usage from the prior year; thus, revenue is recorded in the same year as the usage. • WAC/SAC Fees are dependent upon building permits and are budgeted conservatively. WAC/SAC fees are $2.5M for YTD 2022 vs $1.2M June YTD 2021. • Increase in Interest & Fiscal Charges is due to the bond refunding. YTD 2022 Budget 2022 FY 2021 % of Budget Revenue Other Revenue 16,942 - 8,425 - Charges for Services - - (1,840) - Water Charges 2,906,559 9,116,345 9,379,442 32% Water Meters 33,058 - 45,322 - Water Penalty 49,002 23,000 66,172 213% Sewer Penalty 28,592 50,000 37,806 57% State Health Charges 67,785 100,000 135,550 68% Regular Recycling Charges 354,511 663,244 994,963 53% Sewer Charges 5,339,424 10,260,676 10,287,509 52% Storm Sewer Charges 2,505,244 5,398,070 5,184,312 46% Organics Recycling Charges 377,417 829,417 444,247 46% Water Rec Fee 1,532,420 700,000 665,237 219% Sewer Rec Fee 933,470 450,000 406,878 207% Certification Fee - 15,000 13,020 0% Total Revenues 14,144,424 27,605,752 27,667,044 51% Expenses Salaries (889,606) (2,188,463) (1,896,568) 41% Benefits (321,609) (859,897) (914,375) 37% Contractual Services (5,011,295) (10,776,919) (10,671,009) 47% Commodities (492,303) (1,190,500) (1,148,517) 41% Internal Services (786,836) (1,573,672) (1,387,265) 50% Depreciation (3,063,498) (6,127,000) (5,931,182) 50% Total Expenses (10,565,146) (22,716,451) (21,948,916) 47% Net Operating Inc/Loss 3,579,278 4,889,301 5,718,128 Non-Operating Rev/Exp Invmnt Inc - Non Op (5,960) 302,000 (100,527) -2% Sale of Property 299 - 17,437 - Misc - Non Op 690 20,000 5,642 3% Intergovernmental 34,315 180,000 384,268 19% Int & Fiscal Charges (513,455) (399,348) (84,160) 129% Contrib & Transfers (103,454) (441,000) (752,251) 23% Total Non-Operating Rev/Exp (587,564) (338,348) (529,592) 174% Net Inc/(Loss)2,991,714 4,550,953 5,188,536 Investments The City of Edina (CoE) investments are held in various accounts: Other • Tradition - one year $245,000 FDIC insured Certificate of Deposit held at Tradition Capital Bank. • 4M - Minnesota Municipal Money Market Fund sponsored by the League of Minnesota Cities. The City uses this fund to manage bond proceeds to ensure compliance with IRS regulations. Funds from the 2019A are included in this account. These bonds were issued to fund road reconstruction projects. As construction continues, the balance in this account will decrease. • Crown – one year $245,000 FDIC insured Certificate of Deposit held at Crown Bank. Investment Sweep – Funds not required to clear checks in the City’s checking account are automatically “swept” into this account and invested in commercial paper. The balance in this account changes daily based on the amount of checks outstanding. PFM Asset Management (PFM) – Securian was the City’s outside investment manager through June 30, 2022, replaced by PFM. They oversee a $40M portfolio for the City. These securities are held in a custodian account at U.S. Bank. Funds in this account are not needed for cash flow and can be invested in longer maturities. The benchmark for this portfolio is a combination of the Bloomberg Barclays U.S. Intermediate Government Bond Index and the Bloomberg Barclays U.S. Mortgage-Backed Securities Index. Allowable investments include U.S. Treasuries and Agencies up to, but not including, 10 years and agency mortgage-backed pass-through securities guaranteed by Ginnie Mae (GNMA), Fannie Mae (FNMA) and Freddie Mac (FHLMC). City of Edina – This account is managed internally. The balance in this account at the end of Q2 is $72M. The City uses a network of three institutional brokers who recommend securities in compliance with our investment policy. Funds in this account are managed primarily for cash flow purposes and annual debt service payments. 2023B – This account was created to house investment of bond proceeds at U.S. Bank. Q2 balance is $9.9M. 2021A bond proceeds of $14.4M deposited here in June 2021. 2023C – This account held proceeds from 2021B and 2021C for the refundings of 2013A (Public Works), 2012C (Arena) and 2013B (Golf Dome) in February 2022. The following is a breakdown of total investments by custodian as of 6/30/22: The following represents the total investment pool by security type: Following represents the same data but only for the internally managed piece under custodianship of U.S. Bank (2023A): The following are yields for current investments against a similar benchmark. The internal and external portfolios have different investment strategies. Internal - The internal portfolio is intended to remain sufficiently liquid to enable the City to manage daily City cash flow as well as make debt payments. The average days to maturity for the internal portfolio is approximately one year (including the money market account). Maturities range from one day (money market) to seven years. External - The external portfolio has longer term investment options to optimize return within our investment policy. The external portfolio benchmark of Bloomberg Barclays Intermediate U.S. Government/Mortgage Index represents an investment pool including U.S. Treasuries and Agencies up to, but not including, 10 years and agency mortgage-backed pass-through securities guaranteed by Ginnie Mae (GNMA), Fannie Mae (FNMA) and Freddie Mac (FHLMC). The average days to maturity for the external portfolio is ten years with maturities ranging from one month to 30 years. The later maturities represent mortgage-backed securities. Racial Equity Work PlanGOAL:TARGETSTATUSPROGRESSEvaluate feasibility and advisability of increasing the amount of police-community data collected by the City. 2019 - Q2 In ProgressCAD/RMS vendor will be meeting with police department to plan the system capabilties and department needs. Anticipated build out process will take place between 2022 Q3-Q4. Rollout for new RMS/CAD system is anticipated in 2023 Q32.Investigate available data to desegregate maps of resident population by race and how this data can be linked to allocating funds through City budgeting processes (CIP, PACS, Operating)2019 - Q4 In ProgressPACS prioritization work plan willl continue in 2022. The Equity Criteria for PACS has been completed and will be provided to Transportation Commission for their review. At the same time, previous PACS projects have been used in equity criteria to determine if there would have been different proiritization outcomes.NEW WORK PLAN ITEMS IN 2022GOAL:TARGETSTATUSPROGRESSComplete final report of the 2018 Racial Equity Implementation Plan and incorporate race & equity goals into ongoing department work plans. (Operationalize equity plans)2022 - Q1 Completed2022 Department work plans have been created. Race & Equity Division has met with directors to discuss work plan items with race & equity intersections and how to incorporate race & equity lens in work plan completion. Final report of 2018 Race & Equity Implementation Plan was presented to City Council on June 21, 2022. Quarterly Race & Equity work plan updates will be provided in the Council packets and an annual report will be delivered via presentation at Council meeting.Assess and align City-wide internal demographic data collection process. 2022 - Q4 In ProgressIntial conversations with some departments have started to determine what data is being collected, what is the source, what is the purpose of data, resources needed to manage/secure data.Create/refine Values ViewFinder strategy, tools, and templates for alignment of (Community Engagement, Sustainability, Community Health, and Race & Equity) into City decision-making, and provide quarterly resources and activities2022 - Q2 In ProgressValues ViewFinder tool has been utilized as consideration in Fire Station 2 location decision. The tool will be used in upcoming City processes such as Strachauer Park visioning and CIP Process. Values Viewfinder team discussing training for users.Support the Captial Improvement Plan (CIP) Process2022 - Q4 In ProgressIn alignment with the Values ViewFinder tool, a race & equity lens will be incorporated to support the CIP decision-making process. City Council presentation provided brief introduction to Values Viewfinder tool in the CIP process.Support City departments in work plan development process to further integrate race & equity goals2022 - Q4 In ProgressREAT Work Plan Team is meeting to discuss how to collect input on how to support 2023 work plan development and what information needed to support department directors/designees.GOAL:TARGETSTATUSPROGRESSDeliver staff training on scholarship fund availability to ensure residents are provided the opportunity to apply for financial assistance.2019 - Q1 In Progress Moved to 2022. Training of scholarship funds will be integrated into seasonal/part-time onboard training Q4 trainings.Review and identify if barriers to utilization of Park and Recreationprograms exist and elicit solutions from community members and users.2019 - Q4 On HoldPARC and HRRC provded comments to staff member survey implmentation plan in 2021. Staff members will meet in 2022 to review feedback and create implementation plan for community surveying. Item has been placed on hold until due to current work load capacity. Will revisit in 2022 Q3.Ensure facilities have wayfinding signage and printed materials in multiple languages. 2019 - Q4 On HoldMaps at Centennial Lakes have been updated to be more visitor useable with addition of wayfinding icons; however, this will need to be revisited in 2022-Q3.Employees will be trained on how to support first-time guests of City facilities.2020 - Q4 In Progress Moved into 2022 plan. First-time guest training, employee handbook and race & equity components will be integrated into seasonal/part-time onboard training in Q4 trainings.NEW WORK PLAN ITEMS IN 2022GOAL:TARGET STATUSPROGRESSComplete a route redesign process for snowplow routes. 2022 - Q3 Not Started A race and equity lens will be added as part of the review. Will start in 2022 Q3.Study and review the feasibility of parks & recreation scholarship program, recommendation changes or updates2022 - Q4 In ProgressStaff members from Parks & Recreation and Race & Equity met to determine current state of scholarship program and data. More research is needed to determine/propose what changes are needed and how to implement changes.IN PROGRESS CONTINUATION IN 2022 FROM RACE & EQUITY IMPLEMENTATION PLANIN PROGRESS/ON HOLD - CONTINUATION IN 2022 FROM RACE & EQUITY IMPLEMENTATION PLANACCOUNTABILITY & DATA COLLECTIONCITY FACILITIES & SERVICESUpdated 4.14.2022Page 1 of 3 Racial Equity Work PlanGOAL:TARGETSTATUSPROGRESSEvaluate and improve the police department's current Community Outreach Programs. Consider opportunities for community members to engage with the department.2019 - Q2 OngoingCommunity Engagement Officer in collaboration with Parks & Recreation, Police Department and Fire Department created Art Together events for children and families to work on art projects to promote community engagement and positive interaction with each other. There are three dates in the Art Together series: June 22, July 20 and August 17. June 22 event had over 35 children and families attend.During Community Outreach Program Evaluation, the police department will develop communication strategies to publicize and promote the department through communication methods including social media.2019 - Q2 OngoingA police officer has been assigned to a Communtiy Engagement Officer role. With this assignment, there will be more opportunties to develop more positive community engagement. NEW WORK PLAN ITEMS IN 2022GOAL:TARGETSTATUSPROGRESSHost biennual Public Works Open House2022 - Q2 CompletedPublic Works Open House hosted over 1,700 community members on May 19, 2022. The event marketing in Edition: Edina and event activity card was translated in Spanish, Somali, and English to align with the City's English Proficiency standards.Plan, partner with community members to host City's Juneteenth event2022 - Q2 CompletedREAT Engagement Group, along with HRRC members, organized a Juneteenth event on Sunday, June 19, at Centennial Lakes Park from 11a-3p.Continue to produce Stories We Share on Better Together Edina site2022 - Q4 In Progress Staff members are reaching out to community members who are willing to share their stories.Outreach to larger Edina employers to identify housing needs of employees2022- Q2 In Progress Affordable Housing Division has reached out to employers and provided information on housing opportunties in Edina.Manage Just Deeds Program2022 - Q4 In ProgressLooking at marketing opportunties to increase community interest and participation in Just Deeds. Working with attorneys to create more streamlined notification process and communications with property residents who have completed Just Deeds form on City website.Continue implementation of recruitment and selection strategy for Boards and Commissions to better reflect community diversity2022 - Q4 In ProgressNew Boards and Commisioner members have been onboarded. A data assessment will be conducted prior to the 2023 onboarding process.Provide formal staff training on Plain Language and Limited English Profiency policies, media relations and crisis communications2022 - Q4 In Progress The Communications Department is planning to hold training sessions in Q3 2022 for new staff members.Evaluate and improve current Public Safety community outreach programs in public safety departments; create new opportunities for community engagement through communication strategies and promotions; create assessments2022 - Q4 In ProgressCollaborating with neighboring cities in community engagement opportunties such as Inner Hero (a basketball team event) event held on July 23 in Hopkins. Police Department staff is building relationships through the Cadet program. There were 38 applicants for the Cadet program position in Edina, which had 1 opening. Also looking to partner with Minnetonka, Eden Prarie, Plymouth to create a collaborative marketing program to promotoe community engagement and police officer recruitment.GOAL:TARGETSTATUSPROGRESSDevelop City-wide procedure and policy for responding to complaints that are perceived by staff as possibly racially motivated. Collect data on complaints that seem discriminatory in nature, including who makes the complaints and about whom. Apply this policy to complaints against those belonging to other protected groups.2019 - Q2 In ProgressBias and Discrimination Form has been added to City website for community members to complete. Staff are reviewing resident correspondence, creating staff resource guides and technology solutions to support in better communication and monitoring of public complaints and complaints where bias and discrimination are visible.Review process on using affordable housing funds received from the opt-out option and develop a policy to ensure funds will be used with a race and equity lens.2019 - Q4 In Progress Moved work plan item in 2022. Staff currently use affordable housing funds to create or participate in programs that provide affordability for residents through different options. Staff will create a formalized process and policy that states how affordability and best practices can be meet through a race & equity lens. Review policy and outline requirement and enforcement mechanism to ensure associations and vendors that utilize/rent City facilities are operating in accordance with the city's expectation regarding race equity and inclusion. Post the policy throughout City facilities.2019 - Q4On Hold/Continuation in 2022The policies are currently being reviewed to create more alignment for all associations and vendors. Due to staffing changes, a pause has been placed on this work plan item. Will revisit in 2022 Q3.IN PROGRESS/ON HOLD - CONTINUATION IN 2022 FROM RACE & EQUITY IMPLEMENTATION PLANIN PROGRESS CONTINUATION IN 2022 FROM RACE & EQUITY IMPLEMENTATION PLANCOMMUNITY ENGAGEMENT & COMMUNICATIONSDEVELOPMENT & ENFORCEMENT OF Updated 4.14.2022Page 2 of 3 Racial Equity Work PlanNEW WORK PLAN ITEMS IN 2022GOAL:TARGETSTATUSPROGRESSIdentify zoning and land use regulations that create barriers to affordability and inclusion.2022 - Q4 In Progress Research is being conducted to identify which zoning and land use ordinances create barriers.Review and recommend ordinance for Accessory Dwelling Unit2022 - Q4 In ProgressPlanning Commission working with City staff member to research the Accessory Dwelling Unit ordinance, the impact on community and recommended proposal. Anticipated completion of research and recommendation by end of 2022 Q4 or 2023 Q1.Administer and enhance programs to preserve and grow single family homeownership opportunities: Home preservation program, housing rehab program, Come Home 2 Edina, First Generation Homebuyer program.2022 - Q2 In ProgressStaff is reviewing the current guidelines in single-family homeownership programs and the viability in funding, income limits, home market values and loan limits to ensure there is equitable opportunties.Preserve and enhance affordable housing to prevent displacement of populations.2022 - Q4 In ProgressStaff from Affordable Housing and Sustainabilty divisions working to review home preservation opportunties through sustainabilty and Naturally Occuring Affordable Housing (NOAH) program.Explore viability of equity and inclusion goals when TIF and other public financing is included in private projects2022 - Q3 In ProgressEconomic Developement staff are discussing equty and inclusion good-faith effort goals in contracting, workforce development, recruiting for future TIF financing projects in the City. The contracting and workforce development good-faith goals are in alignment with the Department of Human Rights goals. These potential goals are not enforceable; however, developers are willing to have the conversation to determine what goals, if any, can be added into the contract.GOAL:TARGET STATUSPROGRESSDevelop diversity recruiting strategy for City employees that identifies specific actions to be taken on an annual basis to more closely reflect demographics or Hennepin County.2019 - Q4 In ProgressStaff will be focusing on creating a strategy that distinguishes between sourcing and recruiting in 2022. Future Race & Equity Annual Report to City Council will have more information regarding recruiting and hiring strategies.Train employees on the City code of conduct, safety and security procedures, language interpretation services and cost options.2019 - Q4 In ProgressCarried over into 2022. Training specificially for front line staff will be created and implemented for onboarding seasonal staff in Q3-Q4 2022.Set goals of increasing the percentage of fulltime staff who are people of color and/or fluent in a language other than English.2019 - Q4 OngoingStaff members have collected data to establish baseline information of staff members to start looknig at potential goals in 2022. Staff will review the data in 2022 Q3 and make determination of goals.Research the City’s participation in, or establishment of, a program like Pathways to Policing to develop future candidates for careers in local law enforcement for people of color.2021 - Q4 In Progress Police Department has hosted an open house event, created a recruitment video, planning a Cadet program to engage candidates.NEW WORK PLAN ITEMS IN 2022GOAL:TARGET STATUSPROGRESS100% of Full-time staff to complete staff race & equity training2022 - Q1 In ProgressIn 2021, 88% of full-time staff completed race & equity training. In 2022, four training sessions will be added to achieve 100% of full-time staff. The training sessions have been scheudled for Q3 and Q4.Explore participation with neighboring communities in a "pathways" firefighter program designed to recruit non-traditional candidates2022 - Q4 In ProgressFire Department continues to meet with surrounding schools districts and fire departments to discuss the feasibility of partnering to create programs in schools. Staff members also looking to partner with external agencies in additional cities.Support Century College FireMedic internship program2022 - Q4 In Progress 2022 Firemedic interns could potetntially start in late Q4-2022.Create and facilitate professional development opportunities for staff such REAT 360 2022 - Q4 In Progress REAT Training Group is currently planning to host a training session by end of 2022 Q3.Host an event for staff to engage in different culture, traditions with others2022 -Q4 In Progress REAT Training Group has started to meet with additional City departments to host an event.IN PROGRESS CONTINUATION IN 2022 FROM RACE & EQUITY IMPLEMENTATION PLANEMPLOYEE TRAINING & DIVERSITYDEVELOPMENT & ENFORCEMENT OF POLICIESUpdated 4.14.2022Page 3 of 3